KEGG   Drosophila ananassae: Dana_GF16093Help
Entry
Dana_GF16093      CDS       T01059                                 

Definition
GF16093 gene product from transcript GF16093-RA
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
dan  Drosophila ananassae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dana_GF16093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1219 aa AA seqDB search
MDFIANIIKRPLSVAGSGSHAAAMEATQAPTDVAPRAGGAPLMSTDLGALLDSASEDLLF
LEEQHSNLLMEPLAIPMTSPHITPPTSGRESIQKLLSEINVNLNQVSANEMEHLQAMSGE
LNPLAVKASPKPVSTDQQKALAAAAAAATGGLKLDVDAAPKFGGLPEFDETQIPELAPLS
AEMDAHLKSDHSSSDVFVECLSLHAERYSGDRSDLEAYSSALNDVLEQQMSTASAVTLEN
TFDDPLAVSQHDVSYEPMDVDEVNETMEMLKNVLDPEDHQLLQQQFLVNRPSIAEVNPVL
EIQSARDEAEMVKEEHNTEIPQIPQETDSKEDVLDEMLPRAEMNSLKEDEVSPQLPEHQD
HEEPQDLKELPEEGLMLQSLKTQDILEDLPENTELEHEIEKEASVHEQPEPLELQITIPN
ELESVQIEPESSEPQGIPIASMPVSPPIPTHRPKTAEELEFLALKELPLPDDEAFNETPK
IDSPKQQEEIQKVEPSYCVPVVEVTPTPQRSPESGSSMSAFRSRCSGPPSPTFPIKEPSE
LPSHFPHSPRAPPESEEMPYLEEAVVEPSADRKQSVCIAGVIARSPVCIEITQPSPEKKE
HLNETLPMNEVVSPAALNGTFDSGSRVDNPEEAAPLQASATFAVPLGSADEQQRRTFSVV
NSTEDPEEAKSRRTFSLDPNPELQRRTFSVEQHASPALEATEENIVADDFEPMDVDTSMR
VADITVDRPPVSTSPPIPTHQTLKRAPIHTETHSPSSPPPLGNATVVLEEQALSAKEQAT
LSASDEKDDVFVEHFGAISPVSDDMFKTPQFTSSGFQNQARMKANAVEAAAAGFEAPTSR
NRDAIVCDDEHFYDAEFQDSVTNQNLILNSSDFDYLYTKGSNNAPIDRSSLLLKFDPLLG
APVPVNHPQQQEQTLQNILGSNPNQAQNRPLSPTLEEHETSGGNQSFGVLASAKDTAKKL
DFKPPVDRTKKHAKMSVDVIDNDCNKTFDNSNLNSEDKSHTYNNMDELEKKIKNEVTRSE
DIEKKLKEAEQREEALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQLAQGYERQLQ
EVQTDRDDNYHHLTSLESTFSDLHVKYEKSKQMTSQLKTNEEALLGEKKQLMDNLRLQEQ
RYDKMKSHAMQQLEIANKKLDTYSREHADEVKKLKALLKKEEVSRVSMTEQLQQKSRENA
DLLKICEELIYGKGQGGSS
NT seq 3660 nt NT seq  +upstreamnt  +downstreamnt
atggacttcatcgccaacatcataaaacgccccctaagcgtggccggcagtggttctcat
gcagctgccatggaagcgacacaggcccccactgatgttgccccgagagcaggaggtgct
ccgctaatgtccaccgatctgggtgcattactcgattcggcatccgaagatctgctgttc
ctggaggagcagcacagcaaccttttgatggaacctcttgccatcccgatgaccagtccc
catattacaccgcccaccagcggccgggagagcatccagaaattactgagtgagattaac
gtgaacctgaaccaagtcagtgccaatgaaatggagcacttgcaggcgatgagcggcgag
ttgaatccactggcggttaaggccagccccaagccagtgagcacagatcaacagaaagct
ctggcagcagcagcagcagcagccactggtggcctcaagctggacgtagacgctgctccg
aaattcgggggtcttccagagtttgacgagacgcaaattccggaactggcaccccttagt
gccgaaatggatgctcatcttaaatctgaccactcgagctctgatgtctttgtcgagtgc
ctgtcgttgcacgccgaaagatattccggagatcggtcggatctggaggcctattccagc
gcactcaacgacgtgctggagcagcagatgtccactgcctctgcggtcacattggagaac
accttcgacgatcccctggcagtaagtcagcacgacgttagctacgagcccatggatgtg
gatgaggttaacgagactatggagatgcttaagaacgtcctggacccagaggatcatcaa
ctgttgcagcagcagttcctcgttaatcgtccttctatagccgaagttaatcctgtctta
gagattcaatcggcaagggacgaagctgaaatggtaaaggaagaacacaacacagagatc
ccgcaaatacctcaagaaacggacagtaaggaggatgtattagatgagatgctacctagg
gctgagatgaattctctaaaggaagatgaagtgtcgccacaattaccggaacatcaggac
cacgaagagccacaagatctaaaggaactccctgaagaagggcttatgttgcaatccttg
aaaacacaggatattctggaggatctaccagaaaatacggagcttgaacatgaaatcgaa
aaggaagcatccgttcatgagcaacctgaaccccttgagcttcagataacaattcccaat
gaactagaatcagttcaaattgaacctgaatcctccgagcctcaaggaataccaattgcc
tctatgcctgtgtccccgcccatacccacgcatcgtccaaagacagccgaagaattggag
ttcttggccctcaaagaactgcccctgccggacgacgaagctttcaatgaaacacccaag
atcgattccccgaagcagcaagaagaaatacaaaaagttgagccttcttattgcgtaccc
gtggtggaggtcacacctacaccgcaacgatccccggagtcgggtagtagtatgtctgct
ttccggagtcgctgctctggaccaccttctcccactttccccataaaagaaccctcggag
ctaccctcccacttccctcactcgccgcgtgctccgcccgaaagtgaagaaatgccgtat
ctggaggaggccgttgtggaaccatcggctgatcggaagcaaagcgtttgcatagctgga
gtcattgcccggtcaccagtttgcatcgaaataacgcagcccagccctgagaagaaggag
cacctcaatgagaccctgcccatgaacgaggtggtatcacctgctgcactgaacggcacc
ttcgacagcggtagtcgagtggataatcctgaggaggctgctccgcttcaagcttcagcc
acatttgccgtacccttgggctctgccgacgaacaacagcgacgaactttttctgtcgtc
aactccacagaagacccagaagaggccaagtcccggaggactttttccttggatcccaat
cccgaattgcagcgacgcactttttccgtggagcaacatgcctcgccagcgctggaggcg
actgaggaaaacatcgttgcggatgattttgagcccatggacgtggacacatccatgcga
gtggcggacataacggtggaccggccaccggtttcaacatcgccaccaattcccacacat
cagaccctgaaacgagcgcccattcatacagaaactcattcgccgtcgtcgccaccgccg
ctgggcaatgctacagttgtcctggaggagcaggccttgtccgccaaggagcaagccacc
ctcagtgccagcgacgaaaaagacgatgtttttgtggagcactttggcgccatatcgccc
gtctcggacgacatgtttaagacgccccagttcaccagcagcggattccagaaccaggcc
agaatgaaggcgaatgccgtggaggcagcagccgccggatttgaggcaccgacgagccgg
aacagggatgccatcgtttgtgatgacgagcatttctacgatgcggagttccaggatagc
gtcaccaaccagaacttaatactgaactcatcagattttgattatttgtacaccaaaggc
agcaataatgcgcccatcgatcgcagctccttgcttttaaagttcgatccgctccttgga
gcccccgtgccagtaaatcatccacagcagcaggagcagactctgcagaatatactggga
tctaatcccaaccaggcccaaaacagaccgctcagtcccacattggaggagcacgagaca
agtggcgggaatcaatcgttcggagttttagccagtgccaaagatacagccaagaaattg
gactttaagcccccagtggataggacaaaaaagcatgctaaaatgagtgtggacgtcatt
gacaacgactgtaacaaaaccttcgataattccaaccttaattcggaggacaagtcccac
acctacaacaacatggatgaattggagaagaagattaaaaatgaagttacccgatcagag
gatattgagaagaaacttaaggaggccgagcaaagggaggaagcactcatcaaacgtatc
acggaaaaggacaaaacaaatgctaaacttaacggcgttattgaagcctacgaaaaggcc
attgcggagttaatcagcgagaaggaacagttggcacagggctatgaacggcaactgcag
gaagtacagacagatcgggacgacaactaccatcacttaacgtcgctggaatcgacattc
tcagatctgcatgtgaaatacgagaaaagcaaacagatgacctcgcagctgaaaaccaat
gaggaggctctgctgggtgagaaaaagcagctgatggacaatctgcggttgcaggagcag
cggtacgacaagatgaagagccatgccatgcagcagctagaaattgccaacaaaaagctg
gacacatattcaagagaacatgcggacgaggtgaagaaactgaaagctttactcaaaaag
gaggaggtatcgcgggtctcaatgacggagcagctgcagcagaagtcgcgcgagaacgcc
gatctgctgaagatctgcgaggagctcatctatggcaagggacaaggtggtagtagttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system