KEGG   Drosophila ananassae: Dana_GF16138Help
Entry
Dana_GF16138      CDS       T01059                                 

Definition
GF16138 gene product from transcript GF16138-RA
Orthology
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
dan  Drosophila ananassae
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dana_GF16138
Enzymes [BR:dan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dana_GF16138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1460 aa AA seqDB search
MKLSAGSHSEIEGEGAQSNVSCNPQVPVEIATDAEAVAAAAANAESEAPNQQTVTDITAS
ITEHHDAPEKPPEKLAAISVDVEMDADADKPSAVSDSPAGRQLQKPPQQRLSAMNRKRDL
INLQSALSPKYIGYANANSPTPLSESDETIRTTRRRLNQAAAALNSSSTGESLSRDNDSP
KTVGPGNGAVEGGGIKQYMSPIEKLLMKNGASSPNSTGFEADAEDLAVRPVRKQLKRKMK
RMSKAKVAIGVDSPPLIKESKSEEIDNEPHDTENTSNEINEIITTKCETEVETEAEAEAN
TGAVEVDVPAEDITEAENHVESHAELIEEPKDVEKPSELPFAQPQSTATEAELKSPPDVS
SSTFTQPEVNSSMKSPSSVSIDSAKGLSIVTDPGWPTYQVGDLFWGKVFSYCFWPCMVCP
DPFGQIVGNMPSHPQRSSVDAATVPIQVHVRFFADNGRRNWIKPENLLPFAGLPAFEELR
EEVRIKHGPKSAKYRQMNPKRAKLTIWMQAIEEAQVVTELPYSERLEKFYQIYESVATLN
KQKRKRTNSMMQDTSDVGSSLYDSTDNLLSRQSNQLVAVKRERSESPFSPAFSPVKSKNE
TRAKRRKLSGGIETETGRSSLTVIKQQTQLFSEKSSPDASVYENPEFGQLFDVIKEYVMV
HRNEEKVEKVLLAVVSNIWSLKQIQLRELERDMSNGQMEQQLGSAVMERGRGAGSIKRLS
NRLKTMMVRRSMTPVVAPSPTPAIVEPERRLSEVTKPKKPVNRPIDEVVEDILQLDSKYL
FRGLNREPVCKYCYAPGLNLQRCSRNCNNWLHGDCLERKKSGTPLPKKGGRKIKEISASS
NPQTPVPDIEHVTGDANIMTPLICHECSIGEPEGCVICHQVESPTVASAGSPVKEEEPQT
IAEDKLLTCSQPMCGKRFHVGCCKYWPQASSGKQSPRCPRHVCHTCVSDDPSGKFQQVSN
SKLAKCVRCPATYHQDSHCIPAGTQMLTATHIICPRHNIAKGDAHVNVLWCYICVKGGEL
VCCETCPIAVHAHCRNIPIKTNESYICEECESGRLPLYGEIVWAKFTNFRWWPAIILPPT
EIPSNILKKAHGDNDFVVRFFGTHDHGWISRRRVYLYIEGDTGDGHKTKSQLFKNYTTGV
EEATRFLRIIKTRRQEQAIGRQNGSKLQPPPYAKIKANKAVAPVRFMQNLEELSACDCLP
EHDHPCGPESGCLNRMLYNECNPDFCRAGDRCENRMFEQRISPRLEVVYMNERGFGLVCR
EPIAEGTFVIEYVGEVINHAEFQERLIQKQRNRDENYYFLGVEKDFIIDAGPKGNLARFM
NHSCEPNCETQKWTVNCVHRVGIFAIKDIPANTELTFNYLWDDLMNNSKKACFCGATRCS
GEIGGKLKDGSAKETTSQSAKGKSSSKLKHLGKAKGSMVRIHIGPPKKAKKPPKVKHISA
DDAPVEVEEVKTEPKIAQHD
NT seq 4383 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgagtgcgggttcacactccgaaatcgagggtgaaggcgcccagagtaatgtg
tcgtgcaatccccaggtccctgtggagatagctactgatgcagaggcggtggcggcggcg
gcggccaacgccgagtcagaggccccaaatcagcaaaccgtcaccgatataacggcgagc
ataacggagcatcatgatgcgccagagaagcctccggagaaactggccgcgatatctgtt
gacgtggaaatggatgccgacgcagacaaaccatccgctgtctcagactcccctgctggc
aggcagctgcagaagccgccacagcagcgtctctcagccatgaacaggaagcgcgatcta
atcaatttgcagtcggccctgagccccaaatacatcggctatgccaacgccaactcaccc
acgccactttcggaatcggacgaaacgatacgcacaacgaggagacgcctgaaccaagcg
gcggcggccctcaacagcagcagtaccggcgagagcctgtcccgggacaatgattcacca
aagaccgttggtccaggaaacggtgctgtcgaaggaggcggtatcaagcaatatatgagc
cccatagaaaagttgctgatgaagaacggagccagttcgccgaacagcacggggtttgag
gcggatgccgaagatctggctgtccggcccgttcgaaagcagctcaagcgcaagatgaag
agaatgagcaaagccaaggtagccatcggtgtggatagcccacctctgattaaagaaagt
aagagcgaagaaatcgataatgagccacacgatacagaaaatacttcaaatgaaattaat
gagataatcaccacaaaatgcgagactgaagttgagactgaagctgaagccgaggctaat
actggggctgtggaagtggatgtcccagcggaagacataactgaagccgagaatcacgta
gaatctcacgctgaattaattgaagagccaaaagatgtggagaagccgagcgagctgcca
tttgctcagccccagtcgacggccacagaggccgaactaaaatcgccaccagacgtgagt
tcaagcacattcactcaacccgaggtcaatagctcaatgaaatcgccctcctccgtcagc
atagacagtgcgaaaggcctgtccattgttaccgatcctgggtggcccacctaccaagtg
ggcgacttgttctggggcaaggtcttctcgtactgcttctggccctgcatggtttgtccg
gatccgtttggccagattgttggtaacatgccgagccatccgcagcgctcatccgtggat
gcagccactgttccgattcaagtgcatgtacgttttttcgcggataacggacgaagaaac
tggatcaagccggagaaccttctgccctttgccggtctcccggcattcgaggaacttcgt
gaagaggttcgcatcaagcatggaccaaagagtgccaaatacaggcagatgaatcccaag
agggcgaagttgaccatctggatgcaggccatcgaggaggcccaggtcgtgacagagctg
ccctactcggagcgacttgagaagttttatcagatctatgagagtgtagccacacttaac
aagcagaagcgcaaacgcacaaattccatgatgcaggacacctccgacgtgggcagcagc
ctctacgactccacggacaatttgctcagccggcagtccaaccagttggtagccgtgaag
cgagagcgctccgaatctccgtttagtcccgccttctcgcccgtgaagagcaaaaacgaa
actcgtgccaagcgtcgcaaactcagcggcggcatcgagaccgaaacaggcagatccagc
ctaacagtgatcaagcagcagacacaactcttttcggaaaagagttcccccgacgcctcc
gtttacgagaatccggaattcgggcagctattcgatgtcatcaaggagtacgtgatggtc
catcggaacgaggaaaaagtggagaaggtactcctggctgtggtcagtaacatatggtcg
ttgaagcagatccaactccgcgagcttgagcgcgacatgtccaatggccagatggagcag
cagctgggctcggctgtgatggagcgaggtcgaggcgctggctccattaagaggctgtcg
aatcgtttgaaaacgatgatggtcaggcggagcatgaccccggtggtggcacccagtcca
acaccggctattgtcgagccggagcgcagactgtcggaagttacaaagcctaagaaaccc
gtcaaccgtcccatcgacgaggtggttgaggatatcttgcagctggacagcaaatacctc
ttccgaggactgaaccgagaaccggtatgtaaatactgctatgcgccgggattgaatctg
caacgatgttcgcgcaactgcaacaactggctgcacggggactgcttggagcgaaagaaa
tccggcacacccctgcctaaaaaaggtggccgaaagataaaagagatctcagccagctcc
aacccgcaaacacctgtgcctgatatcgagcatgtgacgggagacgccaacatcatgaca
ccgttgatctgccacgagtgcagcatcggagagccggaagggtgtgtcatttgccatcaa
gtggagtcaccaacggtagcatcagcaggctctccagttaaggaggaggaaccgcaaacc
attgcggaggataaactgctgacttgcagccagcccatgtgcggtaaacggtttcacgtt
ggttgctgcaagtactggccccaggccagtagtggcaagcagtcgccccgctgtccacgg
catgtgtgccacacttgcgtctcggacgatcctagcggcaagttccaacaggttagcaac
tccaagctggccaagtgcgtccgctgtccggccacttatcaccaggactcccactgcatt
cccgctggcacccagatgctaactgccacgcacatcatctgtccacggcacaacatcgcc
aagggggacgcccacgtcaacgtgctctggtgctacatctgcgtcaagggcggagagctg
gtctgctgcgaaacctgtcccatcgctgtacacgcacactgtcgaaatattccgatcaag
accaacgagagttacatctgcgaggagtgcgagagcggaagacttcctctgtacggggaa
attgtttgggcgaagttcactaatttccggtggtggccggcgattatactgcccccgacg
gagatacccagcaatatactaaagaaggcccatggcgacaacgactttgtggtgcgcttc
tttggcacccacgatcacggatggatatccaggaggagggtctacctctacatcgaaggc
gacacgggcgacggccacaaaaccaagtcccagctgttcaagaactacacaaccggcgta
gaggaagcgacacgtttcctgaggatcattaagacccgccggcaagagcaggccattgga
cgacagaatggcagcaagctccaaccgcctccatacgccaaaatcaaagccaataaagca
gtagcgccagtccggttcatgcagaatctcgaggaactaagcgcctgcgactgtctgcca
gagcacgatcacccctgcggcccggagtctgggtgcctcaaccgtatgctgtacaacgag
tgcaatccggacttttgtcgtgccggtgatcgctgcgagaaccggatgttcgagcagcgc
atatcgccccgcctggaagtagtctacatgaacgagcgcggattcggacttgtgtgccgg
gagcccattgccgagggcacatttgtgatagagtacgtcggggaggtcatcaaccatgcg
gaattccaagagcggctcattcaaaagcaacgcaatcgggacgaaaactactacttcttg
ggcgtggagaaagactttatcatcgacgccgggccaaagggtaatctcgctcgattcatg
aaccactcgtgcgagccgaactgcgagactcagaagtggacggtcaactgtgtccatcgt
gtgggaatctttgccatcaaggacattccagcgaacactgagctgactttcaactatctg
tgggacgatctcatgaacaacagcaagaaggcctgcttctgtggagcaacccgctgttcc
ggcgagattggcggcaagctgaaagatggcagcgccaaggaaacgacgtcgcagagcgcc
aagggcaagagcagtagcaaattgaagcatctgggaaaggccaaggggtcgatggtgcgc
atccacatcggaccacccaaaaaggcaaaaaaaccgccaaaggttaaacacattagcgcg
gacgatgcgccggtggaggtggaggaggttaaaactgaacctaaaatcgcccaacatgat
tga

DBGET integrated database retrieval system