KEGG   Drosophila ananassae: Dana_GF16201Help
Entry
Dana_GF16201      CDS       T01059                                 

Definition
(RefSeq) GF16201 gene product from transcript GF16201-RA (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dan  Drosophila ananassae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dana_GF16201
   01230 Biosynthesis of amino acids
    Dana_GF16201
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dana_GF16201
   00051 Fructose and mannose metabolism
    Dana_GF16201
   00562 Inositol phosphate metabolism
    Dana_GF16201
Enzymes [BR:dan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dana_GF16201
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dana_GF16201
  Exosomal proteins of bladder cancer cells
   Dana_GF16201
  Exosomal proteins of melanoma cells
   Dana_GF16201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 366 aa AA seqDB search
MSPNWILKLEKIVEDLALRRLAMKSLQTTLIHKVNFGRVISITLRQPLKNQYHWSTTMDM
NQPTVGGLTVDVVKGVVSQAFLGKFTAVFPKLFKCQWKTYEGQKKFYANFSTDCNESNMS
GRKFCVGGNWKMNGDQKSIADICKTLSSAPLDPNTEVVIGCPAIYLMYARNLLPCEVGLA
GQNAYKVEKGAFTGEISPAMLKDIGADWVILGHSERRAIFKESDELIAEKAQHALDQGLK
VIACIGETLEEREAGKTNEVVARQMCAYAQKIKDWQNVVVAYEPVWAIGTGKTATPDQAQ
EVHAFLRQWLSDNISKDVSASLRIQYGGSVTAANAKELAKKPDIDGFLVGGASLKPEFVE
IINARQ
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccaactggattctaaaacttgaaaaaatcgtcgaggatttggctctccgtcgg
ctagccatgaaatcattgcaaactacattgattcacaaagtcaacttcgggagagtcata
agtataacattgcggcaaccactaaagaaccagtaccactggagcaccaccatggacatg
aaccagcccaccgttggagggttgacggtggatgtggtgaagggggtggtgtcgcaagct
tttctcggcaagttcacagctgtttttccaaagcttttcaagtgccagtggaagacttat
gaaggtcagaagaagttttacgccaatttcagtaccgactgcaacgagagcaacatgagc
ggccgcaaattctgtgtgggaggcaactggaagatgaacggcgaccagaagtccatcgcc
gacatctgcaagaccctgagctccgctcccttggaccccaacaccgaggtggtcatcggc
tgccccgccatctacctgatgtacgcccgcaatctgctgccctgcgaggtgggtctggcc
ggccagaacgcctacaaggtggagaagggtgccttcaccggtgagatctcgcccgccatg
ttgaaggacatcggagctgattgggtcatcctgggtcactcggagcgtcgcgccatcttc
aaggagtccgatgagctgatcgccgagaaggcccagcacgccctggaccagggactcaag
gttattgcctgcattggcgagaccctggaggagcgcgaggccggcaagaccaacgaggtg
gtggcccgccagatgtgcgcctacgcccagaagatcaaggactggcaaaacgtggtggtg
gcctacgagcccgtctgggccattggcaccggcaagactgccactcccgaccaggcccaa
gaggttcacgccttcctgcgccagtggctgagcgacaacatctccaaggacgtctccgcc
agcttgcgcatccagtacggtggctcggttaccgccgccaatgccaaggagctggccaag
aagcccgacattgatggtttcctggttggaggtgcttcgctgaagcccgagtttgtggag
atcatcaatgccagacagtaa

DBGET integrated database retrieval system