KEGG   Drosophila ananassae: Dana_GF16201Help
Entry
Dana_GF16201      CDS       T01059                                 

Definition
GF16201 gene product from transcript GF16201-RA
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dan  Drosophila ananassae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:dan01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dan01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dan00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dan00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dan00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 309 aa AA seqDB search
MDMNQPTVGGLTVDVVKGVVSQAFLGKFTAVFPKLFKCQWKTYEGQKKFYANFSTDCNES
NMSGRKFCVGGNWKMNGDQKSIADICKTLSSAPLDPNTEVVIGCPAIYLMYARNLLPCEV
GLAGQNAYKVEKGAFTGEISPAMLKDIGADWVILGHSERRAIFKESDELIAEKAQHALDQ
GLKVIACIGETLEEREAGKTNEVVARQMCAYAQKIKDWQNVVVAYEPVWAIGTGKTATPD
QAQEVHAFLRQWLSDNISKDVSASLRIQYGGSVTAANAKELAKKPDIDGFLVGGASLKPE
FVEIINARQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggacatgaaccagcccaccgttggagggttgacggtggatgtggtgaagggggtggtg
tcgcaagcttttctcggcaagttcacagctgtttttccaaagcttttcaagtgccagtgg
aagacttatgaaggtcagaagaagttttacgccaatttcagtaccgactgcaacgagagc
aacatgagcggccgcaaattctgtgtgggaggcaactggaagatgaacggcgaccagaag
tccatcgccgacatctgcaagaccctgagctccgctcccttggaccccaacaccgaggtg
gtcatcggctgccccgccatctacctgatgtacgcccgcaatctgctgccctgcgaggtg
ggtctggccggccagaacgcctacaaggtggagaagggtgccttcaccggtgagatctcg
cccgccatgttgaaggacatcggagctgattgggtcatcctgggtcactcggagcgtcgc
gccatcttcaaggagtccgatgagctgatcgccgagaaggcccagcacgccctggaccag
ggactcaaggttattgcctgcattggcgagaccctggaggagcgcgaggccggcaagacc
aacgaggtggtggcccgccagatgtgcgcctacgcccagaagatcaaggactggcaaaac
gtggtggtggcctacgagcccgtctgggccattggcaccggcaagactgccactcccgac
caggcccaagaggttcacgccttcctgcgccagtggctgagcgacaacatctccaaggac
gtctccgccagcttgcgcatccagtacggtggctcggttaccgccgccaatgccaaggag
ctggccaagaagcccgacattgatggtttcctggttggaggtgcttcgctgaagcccgag
tttgtggagatcatcaatgccagacagtaa

DBGET integrated database retrieval system