KEGG   Drosophila ananassae: Dana_GF16332Help
Entry
Dana_GF16332      CDS       T01059                                 

Definition
GF16332 gene product from transcript GF16332-RA
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 422 aa AA seqDB search
MAERPKNLFATGPGPSRSRNPPDQLSLNNLSIRHPPSSTSSTSSGSTSSGSSSSSQHNNV
TRGFPQQPPVAPAATAAVSSSSNSSSAADRHRERIRQQACGKLQFGEGPANTHHFTSDDL
EDEGEIGRGAFGAVNKMIFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIYIV
QFYGALFKEGDCWICMELMDTSLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLKEE
LKIIHRDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPERAKG
YDVRSDVWSLGITLMEVATGTFPYRKWDSVFEQLCQVVQGEPPRLKTSFNGMEFSMEFVD
FVNTCLIKKESDRPKYSRLLEMPFIRRGETSHTDVAVYVADILESMENDGITQFTANQPA
ES
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgaccaaaaaatttgtttgcgactggtcccgggcctagtcgctcgcgcaat
ccgccagatcagttaagcctgaacaacctcagcatccggcatccaccatcgtccacttcg
tccacctcctctggatctacatcctccggctcaagttcctcatcgcagcacaacaatgtt
acccgcggttttccccagcagccaccagtagctcctgcagctacagctgcagtttcaagt
tccagtaatagtagtagtgcagccgatcgtcaccgtgagagaatccggcagcaggcctgt
ggcaaattgcagtttggcgagggtccggctaacacacatcattttacatcagacgatctc
gaggatgagggggaaattggacgcggagcctttggtgccgtcaacaaaatgatattcaag
aaactggacaaagttatggcggtgaaacgcattcgatcaaccgtggacgagaaggagcag
aaacaactcctcatggatctcgaggtggtgatgaagtcaaacgagtgcatctatattgta
cagttttacggagcactctttaaagagggcgattgttggatttgcatggagctgatggac
acttcgcttgataagttctacaagtacatatacgaaaagcagcagcgtcatataccagag
tccattctagccaaaattactgtagctacggtgaatgcgttgaactatttaaaggaggag
ttaaagattatccaccgcgatgtaaagccgagcaatatactgctccatcgtcgcggagac
attaagctgtgtgattttggaatttcgggtcagctggttgattcgatagccaagaccagg
gatgctggctgccggccctatatggcgccggaacgtattgatccggagcgtgccaaaggg
tatgatgtccgcagtgatgtatggtccttgggtataactttgatggaagtggccaccggc
acttttccttatcgtaaatgggattcggtatttgagcagctatgtcaggttgtgcaaggc
gagcctcctcggctaaagacctcttttaatggaatggagttctcaatggagtttgtcgat
tttgtcaatacttgcctaattaagaaggagagcgatagaccgaagtacagtcggttactt
gagatgccctttattcgtcgcggcgagacgagccacaccgatgtagctgtgtatgtagcc
gatattctagagtcgatggagaacgatggcattacgcagtttacggctaatcagccggcc
gaaagttaa

DBGET integrated database retrieval system