KEGG   Drosophila ananassae: Dana_GF16609Help
Entry
Dana_GF16609      CDS       T01059                                 

Definition
GF16609 gene product from transcript GF16609-RA
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
dan  Drosophila ananassae
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    Dana_GF16609
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dana_GF16609
Peptidases [BR:dan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dana_GF16609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1087 aa AA seqDB search
MHEYDVNERKEAPASLPPKEHDDSSNTILKNRSSSKSLQVQVNLHRDKSITGAVEDQIGT
AGVSRVDKLSPTCLTLYPLVVQLVDKAVAPPQAPQAIAEKESKASPKRKRQRRTYAADPT
RCSSLRSRQEPAIIDLTEGATSKQPPTPPPAQAASPTPTEPTEYINPDHFKPEFWNRIEE
EQEQKATGKKRRGGTGRARTRRNKLLSELETYSPETAAAIAAAQLELDATSKPGGPRVSR
KRGHNMSLYDRRHQTTTDERRVANGYGGNGLRAGTSGSTSSEIESQELQSHQYYGSAGGS
NPTGSGSGLNGSSGAVNHAPSMGTLCNIGNSCYLNSVVYTLRFAPHFLHNLHHLIHDLGV
VQQAIVRQQRAKSASLGRNVSAAQLEHARSWSSKDLATSADQYTGLNGGASAAVAGSGGS
ASNKSTHQSVSEKLHELYNSLHGNEMADSTEPYHADTLLHAIQDVNATFEGNQQQDAHEF
LMCVLNCIRETNQSLIKAIGECPEVIANGFVANPDEVDTGEAQERADSAASQSVSSGNGS
LLSSQTTTSTKPSFFSRKSKRKDEVKSSKSTRVQSPLKDNSPTAGTAHATANSLFYLNTV
DLSGANSTGSGSGSVVPTPTVTLPSVTAPQASKYSSDDEMNSATVLKDKMRLEERIRELN
LNFFNADFEGVVVLTTKCLSCETVTRQKQGMIDISVPVPISGYENSDLQDKPSNYIQNSC
ITKEYFRGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRFSGGMEKVSTYVPTSFTL
PCFCIKCCDLSESNKLHVYKLYSVITHVGATLTVGHYIAYTCFLDLASDYVNCPKDRRNT
MTGSQTSSSQSAASNENSAPNNGSSSVASTPVSAAASALASSGTSLMKKMKFGRSKASSS
GDMSKNVKQVNGISSKTITNGIGKLSMNTTCHGVNCCAMRLCCNQQTSNSNSASCSDFSE
ESLQNGSNSNLSYGSSGATYPTGYGSTGRGGVKVNYAHGGTEPIWYMCDDDKIKAMTQRE
FEELLSPTRKITITPYLLFYARFDLQPQQPQTAASKPGTSSTPPPPPSSGSQSSWSNDNV
PSGSHKI
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaatatgacgtaaatgagcgcaaagaggcaccagcaagtcttccacccaaagaa
cacgacgactccagcaacaccatcctcaagaataggagcagctccaagagcctccaggtc
caggtcaatctacaccgggataagtcgataacgggcgccgttgaagatcagatcggtaca
gctggagtgagcagagtcgacaaactctcacccacgtgcctgaccctatatccgcttgtg
gtccagctcgttgacaaggcggtggcaccaccccaagctccccaagccatcgcagagaaa
gaatcgaaagcatcaccgaaacggaagcgacaacgtcgcacctacgccgccgatccaaca
cgctgctcgagtcttaggtcgcgccaggagccagctatcatagacctgaccgaaggcgcc
acttccaagcagccaccaactccgccaccagcgcaggccgcttcgcccacacccacagag
cccactgagtacatcaacccagatcacttcaagccagagttttggaaccgcatcgaggag
gagcaggaacagaaggcaactggaaagaagcgacgaggaggaacgggtcgggccaggaca
cgccggaataagctattaagcgagctagagacctactcgccagaaacggcggccgccatc
gcggcagcacaactcgagctagacgccacatcgaaaccgggaggaccgcgggtcagtcgc
aagaggggacacaacatgtcgctgtacgatcgccggcaccagaccaccacggacgagcgc
cgggtggccaacggttatggcggtaatggtctgcgcgctggcacctctggttccacatct
agcgaaattgagtcccaggaactgcagagccaccagtattacggatccgccggtggtagt
aatcccactggatcgggatcgggcctgaatggcagttcgggagctgtgaatcatgctcct
tccatgggcacgctctgcaacatcggcaattcgtgctacttgaactcggtggtgtacacc
ctgcgattcgccccacacttcctgcacaacctgcaccatctgatccacgatcttggcgtt
gtgcagcaggcgattgtgcgccagcagagggccaagtcggcgtcgctgggtaggaatgtg
agtgccgcgcagttggagcatgcgcgcagttggagtagcaaggacttggccacaagtgcg
gatcaatataccggtctgaacggcggggccagtgctgcggtggctggaagtggtggcagt
gcttcaaataaatccactcaccaatcggtgtcggagaaacttcacgagctatacaacagc
ctacacggaaacgagatggccgactccacggagccgtatcatgcggacacgctgctccac
gccatccaggatgtgaacgccaccttcgagggcaaccagcagcaggatgcacacgagttc
ctgatgtgcgtcctgaactgtattcgggaaacgaaccagtcgctgatcaaggccattggc
gagtgtcccgaggtgattgcaaatggttttgttgctaaccccgacgaggtggacaccggg
gaggcccaggagcgtgctgattccgctgcgtcgcagagcgtgagctccggaaacggatcc
ctgttatctagtcaaacaacaacatcgaccaagccgtcgttcttctcgcgcaagtcaaag
agaaaagacgaggtcaagtcgtcaaagtcaacgcgcgttcagtcgccactcaaggacaac
agtcccacggcgggcacagcccacgccaccgccaacagcttgttctacctaaacacggtt
gatctcagtggcgccaacagcactggtagtggcagtggtagtgtggttccaacaccaact
gtcaccctaccgtcggtgacggctccccaagcatccaaatactccagcgacgatgaaatg
aactcggccaccgttctcaaggacaagatgcgactggaggagagaatcagggagctgaac
ctcaactttttcaatgccgacttcgagggcgtagtggtgctgaccaccaagtgcctgagc
tgtgaaacggtgacgcgacagaagcagggcatgatcgacatctcggtgccggtgccaata
tccggatatgaaaacagcgatctccaggataagcccagcaattacattcagaactcttgc
atcaccaaggagtacttccgcggggagaacaagtatagctgcaatcagtgcactgggtac
actgaagccattcgctccatctcgtacgaggtgctgccgaggctgctggtcatccagctg
aatcgcttctccggtggaatggagaaggtgagtacgtacgtgcccaccagctttacgctg
ccctgtttctgcatcaaatgctgcgacctaagcgagagcaacaagctccacgtctacaag
ctgtacagcgtaatcacccatgtgggggccacgctgacggtgggccactacatcgcctat
acgtgctttctggacttggcgagcgattacgtgaactgcccaaaggatcgccgcaacacg
atgactggctcccaaacgtcgtcctcacagtcagcggcttccaatgagaactcagctccc
aataatggaagcagcagcgtggccagcactccagtgtcggcggccgcctcggccttggcc
tcttccggaacgagcttgatgaaaaagatgaagttcggccgcagcaaggcctccagtagc
ggggatatgagcaagaacgtgaagcaggtgaatggaatcagcagtaagacgatcacgaac
gggattgggaagctcagcatgaacaccacctgccacggagtcaactgctgtgccatgcgg
ctctgctgcaaccagcagacgagcaacagcaactcggccagctgcagcgacttcagcgag
gagtccctgcagaacggcagcaacagcaatctcagctacggtagctcgggcgccacttat
cccacgggctatggcagcaccggacgcggaggcgtcaaagtcaactacgcacacggcggc
acggagcccatttggtacatgtgtgacgatgacaagatcaaagcgatgacccagcgcgag
ttcgaggagttgctgtcgcccactcgcaagattacgataactccttacttgctgttctac
gcacgattcgatttgcagccacagcagccacagactgctgcctcaaagccgggaacatcg
tcaacgccgccgccgcctccatcgagtggatcacagagctcctggtcgaatgataacgtg
cccagtggctcgcacaagatttga

DBGET integrated database retrieval system