KEGG   Drosophila ananassae: Dana_GF16734Help
Entry
Dana_GF16734      CDS       T01059                                 

Definition
GF16734 gene product from transcript GF16734-RA
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dan  Drosophila ananassae
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dana_GF16734
   00053 Ascorbate and aldarate metabolism
    Dana_GF16734
   00500 Starch and sucrose metabolism
    Dana_GF16734
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dana_GF16734
   00860 Porphyrin and chlorophyll metabolism
    Dana_GF16734
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dana_GF16734
   00982 Drug metabolism - cytochrome P450
    Dana_GF16734
   00983 Drug metabolism - other enzymes
    Dana_GF16734
Enzymes [BR:dan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dana_GF16734
Glycosyltransferases [BR:dan01003]
 Others
  Hydrophobic molecule
   Dana_GF16734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 525 aa AA seqDB search
MSRGFSSLGILTLLFVCLLEPKIVKSENILGIFSYTFGSSYLLIEPYLNLLVQRGHQLTI
ISAVTHLPHIEGAHHIRVARLDQQMQDLLDYDYEFEVTKWMEAQFVSDYFFNCSKFVLED
PGVQELIHNKSVEFSMVILEAAHTDALYGFAQHFNAPLVGIAAFGSAWNIDFLAGNSAPS
VYEPMSALGYSPGLSLLEKWYNLIFITEERLVERFIYLPRQIDLYKKYFSDGAASLHDIR
RRFSLILINQHFSLGRVRSNVPNLVEVAGMHLAGQPDPLGDELRAFIEGAEHGVIYFSMG
LQVLEKWLPPGLPEIMINSFKKLKQRVIWKWSDGSIANNTSNVYVSGLLPQREILNHPNV
KLFITHGGLLSIIEAAHYAVPILSLPLFFDQFQNTKRMEKMGVARSLEILNISQEIVVQA
IEDMLNNSSYKQRALDLSERFHDQPMSPIDTAIWWTEYVLRHKGADHMRIAEQEMSLMQY
YNVDIISVLFGRIGFTVLIVIFLGWKLVTLATRNLEYRFNWLMVR
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagaggcttttcgagcttgggcattctgaccctattgttcgtttgcctgctggag
cctaaaattgtaaaatcggaaaacatattgggaatattctcatacacttttggatcatct
taccttctgatcgagccctatttaaacctccttgtccagcggggccaccagttgacaatc
atttcggccgtcacccacttgccgcacattgagggtgctcaccacattcgcgtggcaaga
ctcgatcagcaaatgcaagatctccttgactacgattatgaattcgaggtaaccaagtgg
atggaggctcagttcgtctccgactactttttcaactgttccaagttcgtactcgaggat
cctggcgtgcaggagttaatccacaacaagagtgttgaattctctatggtgattttggag
gctgcccacaccgacgccctttatggatttgctcagcatttcaatgctccgctggtaggt
attgccgcctttggctctgcttggaacattgacttcttggccggcaactccgccccgagt
gtttacgagccaatgtcagccttgggttactcgccggggcttagtttactggagaagtgg
tacaaccttatttttatcacagaagagcgcttggtagagcgttttatttacctgcctcgc
caaatcgatctttataaaaagtacttttctgacggagcagccagtctgcacgatatccgc
cggagattttccctgatcctgatcaaccagcactttagcctgggacgggtacgtagcaat
gtgcccaatttggtggaagtagctggaatgcacttggcagggcagccagatcccttaggc
gatgagctcagggccttcatcgagggtgctgagcatggagtaatatatttttccatgggc
cttcaggtgctggagaaatggctgccgccgggactgcccgagataatgattaattcattc
aagaagctaaagcaacgtgtgatatggaagtggtctgatgggtcaatagcaaacaatacc
agcaatgtgtatgtcagtggactattgccgcaacgcgaaatactaaaccacccgaatgtg
aagctcttcatcacccacggcggtcttttgagcatcatcgaggccgctcattatgccgtc
ccaatactcagcctgcctctcttctttgatcagtttcaaaacaccaagcgaatggagaaa
atgggagtggcccgtagcctggaaattttaaatatctcccaagaaatagttgtgcaggcc
atagaagatatgttgaacaacagctcttacaagcagagagcccttgatttgtccgaaaga
ttccacgaccaacccatgtcccccatcgatacggccatttggtggacggagtacgtcctt
cgacacaagggagccgatcacatgcgaatcgccgagcaggaaatgtcccttatgcaatac
tacaatgtggacataatctctgtgcttttcggacgcatcggcttcactgtcctcatcgtg
attttcctgggatggaaactggtcactttggccaccaggaacttagagtacaggtttaat
tggctaatggtcaggtaa

DBGET integrated database retrieval system