KEGG   Drosophila ananassae: Dana_GF17019Help
Entry
Dana_GF17019      CDS       T01059                                 

Definition
GF17019 gene product from transcript GF17019-RA
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dana_GF17019
Protein kinases [BR:dan01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   Dana_GF17019
Spliceosome [BR:dan03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dana_GF17019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 532 aa AA seqDB search
MSNELSELIALGCPDLGSQKPVELILNTERRLSIKQMTATDLASLRAAAAAEAEARARMQ
AEAEARAIAQEQVRMAREAEAKARARAALEVQAQLQRVMESEKRRQEQEENQKDQEEEEE
DEEDADAQDDDPPKGSLPSNAAPRERITSLPNILDDAMEMHLLSVSQPKATFKDESSPEK
SRSHIADSIELLRMQRAARDVRSHNRTRERSISPAGRNRERSAAPDRLQSSASMSSLDSA
SVSKATSRRGSTSSASGVEPPPPPAPLASKFPLSKTVSAPNMMNRRKSSLTSMFPGPSPL
MAPEPSLHTNPNALPPEEEPLHRRQEDGYREIPSGKMVHRTKTPPPVGANLGVSLKRVQA
PSGSITIKPKESPMLGVVLRKVEKKTVPQKSILDDDKPLYHFSIVRSDNKEHVPAQKPKP
KPAPPAAKPSPGGILTGPQVIRTAQPRQAVPVKPQRPLPGVPITITKIEGDKIIIIKKIV
VPKNSKIPEQYLQVGRLHPRPRPRPVGDRSGVWCYLVSPPPSCMSFVRNLFL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgaactcagtgaactcatcgcccttggctgtccggacctgggctcccagaag
ccagtagagttgatcctgaacacggaacgacgtctgagcatcaagcagatgacagccacg
gatctggccagtctccgggcagcagcggccgccgaggcggaagccagagcacggatgcag
gcggaggcggaagcccgggccatagcccaggaacaggtgcgtatggcccgcgaggctgag
gccaaggccagagcccgagctgccctcgaggtgcaggcgcagttgcagcgcgtcatggag
agtgaaaagcgtcggcaggagcaggaggagaaccagaaagatcaggaggaggaagaggag
gacgaagaagatgcggatgctcaagatgatgacccgcccaagggctccctgccttcgaat
gcggctccccgcgaacgcatcacctcgttgcccaacatcctggatgacgccatggagatg
cacttgctcagcgtttcccaacccaaggccacgttcaaggatgagtcctcgccagagaag
agccgctcccacatagccgattctatcgaacttctgcgaatgcagcgcgctgcccgggat
gtccgatcccacaatcgtacccgggaacgttccatttccccggccggtcgtaaccgcgag
cggagtgccgctcccgatcgcctccagagttcggccagcatgagcagcttggattcagct
tccgtcagcaaggcgactagtcgacgcggaagcacctccagtgcctcgggagtcgagccg
ccacctccgcctgctcctctggcttccaaattcccactctccaagacggtttccgccccg
aacatgatgaaccggcggaagagcagcctcacatccatgtttccgggcccatcgccgttg
atggctcccgaaccatcgctgcacaccaatcccaatgccctgcccccggaagaggagcct
cttcacaggcgccaggaggacgggtaccgcgagatacccagtggaaagatggtccaccgc
accaagacacccccaccggtgggcgccaacctgggagtgagtctgaaacgtgtgcaagct
cccagtggctcgatcacaatcaagcccaaggagtcgcccatgttgggcgtggtgctgcgc
aaagtggaaaagaagacggtgccgcagaagagcatcctggacgacgacaagcccctgtat
cacttctccatagtgcgcagtgataacaaggagcacgtgcccgcccagaagcccaaaccg
aagccagctcctccggctgcgaagcccagtcctggtggcattctgaccggaccccaggtc
atccggactgctcagccaaggcaggcggtgcccgtgaagccgcagcgcccactgcccggc
gtgcccatcacaattaccaagatcgagggcgacaagataatcatcatcaagaagatagtg
gtgccgaagaatagtaagataccggagcagtatctgcaggttggtcgtctacatccacgt
ccacgtcctcgtcctgttggtgatcgttctggtgtctggtgttatttggtgtctcctcct
ccgtcctgtatgtcctttgttcgaaatctgtttttatag

  All links  
No link information was found.   
DBGET integrated database retrieval system