KEGG   Drosophila ananassae: Dana_GF17020Help
Entry
Dana_GF17020      CDS       T01059                                 

Definition
(RefSeq) GF17020 gene product from transcript GF17020-RF
  KO
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dana_GF17020
Protein kinases [BR:dan01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   Dana_GF17020
Spliceosome [BR:dan03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dana_GF17020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 2075 aa AA seqDB search
MSNELSELIALGCPDLGSQKPVELILNTERRLSIKQMTATDLASLRAAAAAEAEARARMQ
AEAEARAIAQEQVRMAREAEAKARARAALEVQAQLQRVMESEKRRQEQEENQKDQEEEEE
DEEDADAQDDDPPKGSLPSNAAPRERITSLPNILDDAMEMHLLSVSQPKATFKDESSPEK
SRSHIADSIELLRMQRAARDVRSHNRTRERSISPAGRNRERSAAPDRLQSSASMSSLDSA
SVSKATSRRGSTSSASGVEPPPPPAPLASKFPLSKTVSAPNMMNRRKSSLTSMFPGPSPL
MAPEPSLHTNPNALPPEEEPLHRRQEDGYREIPSGKMVHRTKTPPPVGANLGVSLKRVQA
PSGSITIKPKESPMLGVVLRKVEKKTVPQKSILDDDKPLYHFSIVRSDNKEHVPAQKPKP
KPAPPAAKPSPGGILTGPQVIRTAQPRQAVPVKPQRPLPGVPITITKIEGDKIIIIKKIV
VPKNSKIPEQYLQMSEDAGKPAVAVPPTATAAAANLKPKEDTVQSQPAAMQKPTPPPASG
QQFFQMVSPQFASVMSSSIPESKCAVRSPISSPLAIRKSRPPMLPASPKSTPPLPRKHHP
LAYNAATGTISSASGSALPSRLMATIASSPASSISLSSSSSPSSSPPPPVPCRAPKNAAK
PAAPEISLDKLLQQQQELEEKSAAATNSAKLDANFYDAEIEMMNKYLKSLPDYSELDRKL
HQEFQECEDLYDKLKRQQHPLAKSNSQQSVTKTAPGGAVGGGLPAISSGLSKSSSINFAQ
NPSTRGVAPRMAYPSIFAQTSGEPKLQRSISSSNMPLSTPTPMRPLPAKNGLQSGSNLSL
NKQLMNEFWSENLNSSQKRQTPKRTFWNYEKICGAQLGDAGQPFKVDAKTAKKLAIFDPT
VAEAAQKELQRPQQNKLQKNASLSHLDLKVRQAVTKDDLYKLICNEQSPSTAGGASFVSR
VPVKQQQPQPLQAQQQQQVHPLQSQALPKSVSMTHVPGGGGPAPLLRTSSRTHIPCYMKH
LPSLSRSTSNSAILMSSQPRKDQPLTKEAPKATVPAAVATTKASGVLKSSSSSCVPSPRC
AAAFFRRPQETYNPQPVVPKEAQVVAPPNESTGNPGDSVSLERKSEKSNSTISTSSFTVT
NCCTTHLPQLSKFTSSFHIAPTPATATTATATTTATSATSSAPTTAATSAPSEQQQQQQP
GGAAAANLEVPTSSSSSSAGSSATTKRQKDVDNKLEKCLNDMLKLKTNNATTSTGNSNHN
GGNNNALMSMSQSLAVAGASVAEDDHKEPKTTGEGPPSTNSNGSNTNNGSKYLGESQIPV
PVQLYDPQKPLLQQQQQQQQRICYPIGKSNSTSQVPMGGYQRLLQQQQQQYQDQQQQQQQ
QQQQYPQHKRPFLNWNSFACSAMNGASDPFMQQQQHMPHQQQHHFPHKLQQSYSSSNVNK
QTPKSGLAMFLQKNTNKENKFGQPLSQQPPGMMPQMYGYQGPSKMGYPRSSGGAPLTHSV
SFSSAQRPSALHFHQQHQQQQQQQQQHQHPQQQHSNFGLGMMSRNYYNLPKQQQQQPTLP
ERKPLQTFDPYAYPKPNQMQPVKYQQQQPHQQQPHPHTPFLNASAGAGGGGGGGGVGAAA
SGLQYDPNTNTQLFYASPAASSSTGVQPQQPQQQQQQQQQQLQQSNSVIFNHQQQQQQLQ
QQNEMSKSALGLHFIETAKPVIQDDADGHLIYHTGDILHHRYKIMATLGEGTFGRVVKVK
DMERDYCMALKIIKNVEKYREAAKLEINALEKIAQKDPHCDHLCVKMVDWFDYHGHMCIV
FEMLGLSVFDFLRENNYVPYPLDQVRHMAYQLCYSVKFLHDNRLTHTDLKPENILFVDSD
YTAHYNHKLNREVRRVKSTDVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPC
DVWSIGCILFELYLGITLFQTHDNREHLAMMERILGQIPYRMARNHTLYSKTKTKYFYHG
KLDWDEKSSAGRYVRDHCKPLFLCQLSDSEDHCELFSLIKKMLEYEPSSRITLGEALRHP
FFDRLPPHQRVGEMSNKQPLSSGSSSRERSHSLSR
NT seq 6228 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgaactcagtgaactcatcgcccttggctgtccggacctgggctcccagaag
ccagtagagttgatcctgaacacggaacgacgtctgagcatcaagcagatgacagccacg
gatctggccagtctccgggcagcagcggccgccgaggcggaagccagagcacggatgcag
gcggaggcggaagcccgggccatagcccaggaacaggtgcgtatggcccgcgaggctgag
gccaaggccagagcccgagctgccctcgaggtgcaggcgcagttgcagcgcgtcatggag
agtgaaaagcgtcggcaggagcaggaggagaaccagaaagatcaggaggaggaagaggag
gacgaagaagatgcggatgctcaagatgatgacccgcccaagggctccctgccttcgaat
gcggctccccgcgaacgcatcacctcgttgcccaacatcctggatgacgccatggagatg
cacttgctcagcgtttcccaacccaaggccacgttcaaggatgagtcctcgccagagaag
agccgctcccacatagccgattctatcgaacttctgcgaatgcagcgcgctgcccgggat
gtccgatcccacaatcgtacccgggaacgttccatttccccggccggtcgtaaccgcgag
cggagtgccgctcccgatcgcctccagagttcggccagcatgagcagcttggattcagct
tccgtcagcaaggcgactagtcgacgcggaagcacctccagtgcctcgggagtcgagccg
ccacctccgcctgctcctctggcttccaaattcccactctccaagacggtttccgccccg
aacatgatgaaccggcggaagagcagcctcacatccatgtttccgggcccatcgccgttg
atggctcccgaaccatcgctgcacaccaatcccaatgccctgcccccggaagaggagcct
cttcacaggcgccaggaggacgggtaccgcgagatacccagtggaaagatggtccaccgc
accaagacacccccaccggtgggcgccaacctgggagtgagtctgaaacgtgtgcaagct
cccagtggctcgatcacaatcaagcccaaggagtcgcccatgttgggcgtggtgctgcgc
aaagtggaaaagaagacggtgccgcagaagagcatcctggacgacgacaagcccctgtat
cacttctccatagtgcgcagtgataacaaggagcacgtgcccgcccagaagcccaaaccg
aagccagctcctccggctgcgaagcccagtcctggtggcattctgaccggaccccaggtc
atccggactgctcagccaaggcaggcggtgcccgtgaagccgcagcgcccactgcccggc
gtgcccatcacaattaccaagatcgagggcgacaagataatcatcatcaagaagatagtg
gtgccgaagaatagtaagataccggagcagtatctgcagatgagtgaagatgcgggcaag
ccagcagttgcagtgcccccaacggctaccgccgcagccgcaaacctgaaacccaaagag
gacaccgtccaatcccagccagcagccatgcagaagcccacgccgccgcccgcgagcggc
cagcagttcttccaaatggtctccccgcagttcgcctcggtgatgtcgtccagcatcccg
gagagcaagtgcgccgtgagatcccccatatcatcgccgttggccatacgaaagagtcgg
ccgccgatgctgccggcgagtcccaagtccacgcctcctctgccccggaagcaccatccc
ctggcctataatgctgccaccgggacgatcagcagcgcctccggttcggccttgccctcg
cggcttatggccaccattgcctctagtccggcatcgagtatatcgctgtcgtcgtccagt
tctccctcgtcgtcgccgccgccgccggtgccgtgtcgggcgccgaaaaatgccgccaaa
ccggcagctccggagatcagtctggacaagttgctgcagcagcaacaggaactggaggag
aaatcggccgctgccacgaacagtgccaagttggatgctaatttctacgatgccgagatc
gagatgatgaacaagtatctgaagagcctgcccgactacagtgagctggacaggaagctg
caccaggagttccaggagtgcgaggatctctacgacaagctcaagcgccagcagcaccct
ttggcgaagtccaactcccagcaatcggtgacgaaaacagccccaggaggggcagtggga
ggaggtcttcccgctatctcctccggcttgtccaagtcgtcgtccattaactttgcccag
aatcccagcactcgtggagtggccccccgcatggcctatccctcgatcttcgcccagacc
agtggcgaaccgaagctgcagcgaagcatctccagctccaacatgccgctgagtaccccg
actcccatgcgcccgctgcccgccaagaatgggctgcagagtggctccaatctgtcgctg
aacaagcagctgatgaacgaattctggagtgagaacctgaacagttcccagaagcggcag
accccgaagcgcaccttctggaactacgagaagatttgtggcgcccagttgggggatgcc
gggcagcccttcaaggtggacgccaagacggccaagaagctggccatcttcgatccgact
gtggccgaggcggcccagaaggagctgcagcgcccgcagcagaacaagctgcagaagaac
gcctcgttgtcgcacctggatctcaaggtccgtcaggccgtgaccaaggacgatctctac
aagctcatttgcaacgagcagtcgccgtcgacggcgggaggtgccagctttgtgagcagg
gttcctgtcaagcagcagcagcctcagccgctccaggcgcagcagcagcaacaagtgcat
ccgctgcaatcccaggctctgcccaagagcgtctccatgacacatgtgccgggcggagga
ggaccagcgcccctgttgcgaacctcgagtcgcacccacataccctgctacatgaagcac
ttgccatcgctcagccggagtacttccaactcggcgatattgatgtcatcgcagcctcgg
aaggaccagccgctgacaaaggaggctcccaaagctacagtcccggctgcagttgccacg
accaaagccagcggcgtcctgaagagttccagcagttcctgtgttccgtcgcccaggtgt
gcggctgccttcttccgccgcccacaggaaacgtacaacccgcagccggtggtgcccaaa
gaggcccaagtggtggcgcctccaaatgagagcactgggaaccccggcgactctgtgtcc
ctcgaacgcaagtcggagaagagcaacagtaccattagcactagcagctttacggtgacc
aattgctgcaccacccacctgccgcagctctccaagtttacctcatcgttccacattgcc
ccgaccccggccactgccacgacagccacggcaactactacggcgacctcagctaccagt
agtgcacccacgacggcagcaacatcagcaccaagtgaacagcaacaacagcagcagcct
ggtggcgctgcagctgccaacttggaggtgccaacgtcgtcatcctcgtcatcggccggc
tcgtcagcgaccacaaagcgccagaaagatgttgacaacaagctagaaaaatgcttgaac
gacatgctaaagttgaagaccaacaacgccactaccagcactggcaacagcaaccacaat
ggcggcaataataatgcactcatgtcgatgtcgcagtcgttggcagtggcgggggcgtcg
gttgcagaggacgatcacaaagagccgaagaccacgggcgaaggccccccgagcaccaat
agcaacggcagcaacaccaacaatgggagcaagtacttgggtgaatcgcagattcccgtg
ccagtgcagctttacgatccacagaagccgctgctgcaacagcaacagcagcagcaacaa
aggatctgctatccgataggcaagtcgaattctacctcacaagtgcccatgggtggatat
cagagattgttgcaacagcaacagcagcagtatcaggatcagcagcagcagcaacaacaa
caacaacagcaatatcctcagcataagcgacctttcctgaactggaacagcttcgcctgc
tcggccatgaatggagccagtgatcccttcatgcaacagcaacagcatatgccccatcag
cagcaacatcatttcccgcacaagctgcagcagtcgtactcctcctcgaatgttaataag
caaacgcccaaatcgggcctggccatgttcctgcagaagaataccaacaaggagaataaa
tttggacaacctttgtcgcaacagccgcccgggatgatgccacagatgtacggctaccag
gggccctcgaaaatgggctacccgcgatcgagtgggggtgctcccctgacgcactcagtc
tccttcagctccgcccaacgaccctcggccttgcacttccaccagcaacatcagcagcag
cagcagcagcaacagcaacatcagcacccccagcaacagcattccaactttgggctgggc
atgatgagtcggaattactataatctgcccaagcagcagcagcagcagccgacgctgccg
gagcggaagccgttgcagacctttgatccgtatgcctatcccaagccgaatcaaatgcaa
ccggtcaagtaccaacagcaacagccacatcaacagcaaccacatccgcatacgccgttt
ctgaatgcttccgccggcgctggcggtggaggtggaggtggtggggtaggcgctgctgct
tctgggctacaatatgatccaaatacaaatacgcaattgttttacgcgtcgccggcggcg
tcatcctctacgggcgtgcaaccacagcaaccgcaacagcaacaacagcagcagcagcaa
cagctacaacaaagcaattctgtcatattcaatcaccagcagcaacagcaacagttacag
cagcaaaatgaaatgtccaagtccgctttgggactgcatttcatcgagacagcaaagccc
gtcattcaagatgatgctgatggtcacttaatttaccacaccggagacattctccatcac
agatataagatcatggccacactgggcgagggtactttcggacgtgtggtcaaggtcaaa
gacatggagcgtgattactgcatggccctgaagattataaagaacgtggaaaagtaccgc
gaagctgccaagctcgagattaatgccttggaaaagattgcccagaaggatccgcattgc
gatcacttgtgcgtaaaaatggttgactggtttgattatcacgggcatatgtgcatagtt
tttgaaatgttgggattaagtgttttcgattttttgcgtgagaacaactatgtgccatac
ccgctggaccaagtgcgccacatggcctatcaattatgctactccgtgaaatttcttcat
gacaatcgtttaacgcacacagatctcaagccggagaacatactttttgtcgattcggat
tacactgctcactacaatcataagcttaaccgcgaggtgcgccgggtaaagagcacggat
gtgcgtcttattgacttcggatcggccacctttgaccacgaacaccacagcacaattgtc
tcgacgcgacattatcgcgcgcccgaggtcatactggagctggggtggtcacagccctgt
gacgtttggtccattggttgcatcttgttcgaactctatctggggatcacgctcttccaa
acgcacgacaatcgcgagcacctggccatgatggagcgaatcttgggacaaataccatat
cgcatggcacgcaatcatactctttacagcaaaaccaaaacaaagtacttttatcatggt
aagttggattgggacgagaagtccagtgccgggcgctacgttcgcgaccattgcaagccg
ttgttcctgtgccagctaagcgatagcgaggaccactgtgagctcttcagtctgatcaag
aagatgctggagtacgagccctcatcgcgcatcacgttaggtgaggccctgcgccatcct
tttttcgaccggctgcctcctcaccagcgggtgggcgagatgagtaacaagcaacccctc
tcatcaggcagcagcagccgcgagcgctctcacagtctgtccagatga

DBGET integrated database retrieval system