KEGG   Drosophila ananassae: Dana_GF17020Help
Entry
Dana_GF17020      CDS       T01059                                 

Definition
GF17020 gene product from transcript GF17020-RA
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1260 aa AA seqDB search
MATFLNRFHREKSEKILPIAENGKTADSEASQSQAAVQQQQQQQQQQPQPRPQRRYMRSA
TAASVTQLLSESCNSLLQRFRRNPSERPDNKQHQQQQQQHQQEQQKQQQQEQVQLQLQQQ
QHQPRSNRAEDSRRSCSKTPTNDSNNNNNNNNSKGKSGSAANQSQKQSKRRRSSDKSSTS
SRRHPEGERERDRERERDREMSDRHRRYYAGGGLGSTAGLGYHPSSSGSGSSAALMGRYQ
KSSTTASALDRLRTHLSPVGGYYKPLIRGLGSGGRRDRDLDDRRDLLLDKDRTPTTLTST
TSASTSTSSGGKQSAISRLENKYSDILERAAGRRRHEEDRDKTLEPDDYGASSSSGLLRS
ATSHQLAKSKLSSSSFNASDRKERTPYRTRAQRQRYMADSTDSGYLTSGNRLLDESYPLD
YGQRYDYHDALRLGGATGYPSSRYGRRGGEEEAAPSQRSARAYGRTKTMEGLLSADIQTD
HHPVEDRPLNSRNRFAHRRKEQPPPELTAEEREILADDRSSEDNAAILMLLREDNQFLEA
KKFEERMRKRRELKDRVKRMEEAAEEAKKNEAAVAAAEAEAAALEQEAKKAKEAAAAAAA
AASAAAAAAAVVEAPLEAPKKKSRTKKVTSDDSDESTSGSSSDEAETETETDSAAPGVQQ
LTHTTTPQTANGSTTTSTSSATGTANTTTTSSSNTTTSSSTLSTSTSALSSANHTTTAAA
AATTSNHLGTTNQSRFLTTHSDRNNNDLAKYKPGNQLMHSSSSGALAFGGIGARLAAADA
RRQQQRYQGASSRTAAVLSEFDRYKPGSSGSSYLQDSYGSSSSSRRSNALGLGSSLYPQR
SHLDGYQQQQSSSSSYLQQHDNYSLAKSATSSALFHRSRIPKTLSTFTAKPVIQDDADGH
LIYHTGDILHHRYKIMATLGEGTFGRVVKVKDMERDYCMALKIIKNVEKYREAAKLEINA
LEKIAQKDPHCDHLCVKMVDWFDYHGHMCIVFEMLGLSVFDFLRENNYVPYPLDQVRHMA
YQLCYSVKFLHDNRLTHTDLKPENILFVDSDYTAHYNHKLNREVRRVKSTDVRLIDFGSA
TFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCILFELYLGITLFQTHDNREHLA
MMERILGQIPYRMARKTKTKYFYHGKLDWDEKSSAGRYVRDHCKPLFLCQLSDSEDHCEL
FSLIKKMLEYEPSSRITLGEALRHPFFDRLPPHQRVGEMSNKQPLSSGSSSRERSHSLSR
NT seq 3783 nt NT seq  +upstreamnt  +downstreamnt
atggccacatttctgaatcgttttcatcgcgaaaaaagcgaaaagattctgccaatcgcc
gagaatgggaaaacagctgactcggaggcgtcgcagtcacaggcagcagtgcagcagcag
cagcagcagcagcagcagcagcctcagccgcgtccgcagcgacgttatatgcgcagcgcc
accgctgccagcgtcacccagctgctctccgaaagctgcaacagtctgctgcagcggttt
cgaaggaatccgagcgaacgacctgataataaacagcatcagcagcagcagcagcaacat
cagcaggagcaacaaaagcaacagcaacaagagcaagtgcaactgcaactgcaacaacag
caacatcagccacgcagcaatcgtgccgaggattcgagacgcagctgctccaagacccca
acgaatgacagcaacaataacaataacaataacaatagcaagggcaagagcggatcagca
gctaatcagtcccagaagcaaagcaaacgtcgccgcagctcggacaaatcttccacatct
agccggaggcatccggaaggggaaagggaacgtgatcgggaacgggaacgcgatcgagag
atgagcgatcgccatagacggtactatgcgggcggcggcctcggctccaccgccggtctg
ggctaccatcccagcagcagcgggagcggcagcagcgccgccctgatgggccgctaccag
aagagctccaccacggccagcgccctggacagactgcgcacccacctgagtccggtgggt
ggctactacaagcctcttatccggggcctgggcagcggaggaaggcgggaccgcgaccta
gacgatcgacgagatctgctcttggacaaagacagaacacccaccactctcacctcaacc
acctccgcctccaccagcacctcctccggtggcaagcagtcggccatctcccggctggag
aataaatactcggacatcctggagagggcggccgggaggcgacggcacgaggaggatcgg
gacaagactctggaaccggacgactacggcgccagcagcagtagcgggctgctccggtcg
gccacctcccaccaattggccaagtcgaagctatcctccagctccttcaacgcctccgat
cgcaaggagcgcactccctaccgaacccgcgcccaaaggcagcgctacatggccgactcc
accgacagtggctacctcaccagcggcaatcggctgctggacgagagctatccactggac
tatggccagcggtacgactaccacgacgccctgcgcctgggcggggccacgggctatccg
tccagtcggtatgggcgccggggtggcgaggaagaggcggccccctcccagcgatctgcc
agagcctacggcaggaccaagaccatggaggggctgctgtctgccgacattcagacagac
caccacccggtcgaagatcgacccttgaactcaagaaaccgcttcgcccaccgacgcaag
gagcagccaccgccagagctgaccgccgaagaacgcgagatcctggccgatgaccgctcc
tcggaggacaatgctgccattttgatgctgctgcgcgaggacaaccagttcctcgaggcc
aagaagttcgaggagcggatgcgcaagcgccgcgagctgaaggatcgggtcaagcggatg
gaggaggcggccgaggaggcaaagaaaaacgaggcggcagtggcggccgccgaagcggag
gctgccgctctggagcaggaggccaagaaggccaaggaggcggcagcggcagcagcagcg
gcggcatctgcagcggcagcagcagcagcagtagtggaggcgccacttgaggcgcccaag
aagaagtcgcgaaccaaaaaagtaactagtgacgatagcgatgagagcacgtcggggagt
agctccgatgaggccgagacagaaaccgagaccgattcggcggcgcccggtgtgcagcaa
ctaacccacactaccacgccacagacagccaatggcagcaccaccacatccacttcttct
gccacaggcacagccaacaccaccactacttcctcctcaaacaccacaactagctcctcc
actttatccactagcacttccgctctatcttccgctaaccacacgacaacggcagcggcg
gcggcgacgacctcgaaccacctcggaaccaccaaccagagtcgttttctgaccacccac
tcagatcgcaacaacaatgatctcgccaaatacaagcccggcaaccagctgatgcactcc
tccagctccggggccctggcttttggcggaatcggagcacggctggcggcggcggatgcg
aggcggcagcagcaacgctaccagggtgccagctcccgcaccgcagccgtgctcagtgag
ttcgatcgctacaagccaggctcgtccggatcgagctacctccaagactcgtacggaagc
agcagcagcagccggcgctccaatgccctgggcctgggctcctcgctgtatccgcaacga
tcccacctggatggctaccagcagcagcagtcctcctcctcctcgtacctgcagcagcac
gacaactattcgctggcgaagagcgccacctcgtcggcgctgttccacaggtcacgcatt
ccaaagacactctcgacctttacagcaaagcccgtcattcaagatgatgctgatggtcac
ttaatttaccacaccggagacattctccatcacagatataagatcatggccacactgggc
gagggtactttcggacgtgtggtcaaggtcaaagacatggagcgtgattactgcatggcc
ctgaagattataaagaacgtggaaaagtaccgcgaagctgccaagctcgagattaatgcc
ttggaaaagattgcccagaaggatccgcattgcgatcacttgtgcgtaaaaatggttgac
tggtttgattatcacgggcatatgtgcatagtttttgaaatgttgggattaagtgttttc
gattttttgcgtgagaacaactatgtgccatacccgctggaccaagtgcgccacatggcc
tatcaattatgctactccgtgaaatttcttcatgacaatcgtttaacgcacacagatctc
aagccggagaacatactttttgtcgattcggattacactgctcactacaatcataagctt
aaccgcgaggtgcgccgggtaaagagcacggatgtgcgtcttattgacttcggatcggcc
acctttgaccacgaacaccacagcacaattgtctcgacgcgacattatcgcgcgcccgag
gtcatactggagctggggtggtcacagccctgtgacgtttggtccattggttgcatcttg
ttcgaactctatctggggatcacgctcttccaaacgcacgacaatcgcgagcacctggcc
atgatggagcgaatcttgggacaaataccatatcgcatggcacgcaaaaccaaaacaaag
tacttttatcatggtaagttggattgggacgagaagtccagtgccgggcgctacgttcgc
gaccattgcaagccgttgttcctgtgccagctaagcgatagcgaggaccactgtgagctc
ttcagtctgatcaagaagatgctggagtacgagccctcatcgcgcatcacgttaggtgag
gccctgcgccatccttttttcgaccggctgcctcctcaccagcgggtgggcgagatgagt
aacaagcaacccctctcatcaggcagcagcagccgcgagcgctctcacagtctgtccaga
tga

DBGET integrated database retrieval system