KEGG   Drosophila ananassae: Dana_GF17135Help
Entry
Dana_GF17135      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
dan  Drosophila ananassae
Pathway
dan00730  Thiamine metabolism
dan00790  Folate biosynthesis
dan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Dana_GF17135
   00790 Folate biosynthesis
    Dana_GF17135
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dana_GF17135
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dana_GF17135
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dan00537]
 Enzymes
  Dana_GF17135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase
Motif
Other DBs
NCBI-GeneID: 6499923
NCBI-ProteinID: XP_001953627
FlyBase: FBgn0094154
UniProt: B3M1S8
Position
Unknown
AA seq 479 aa AA seqDB search
MPTPHRTKEICRAVRLKSTQVFIVAGTILITVLVTLVCIGLTTRYEVENEVANVADVDYW
KDRVSAVQKVWYDKGIAELNEALRKPRGPLFPKNVLIFMVQGVGGGDLAAYRFPVISGNS
QGNTNFLWDTFSHVARLKNSCSQQSPCQVGSVSRALWSGIPLDVSLGGESDCWIADNQTD
NFLSVVRQAQLAGLRTGFVTDQRITGTTGAALYGNSKYECDERMPVGSIQMGCQDIARQL
ISGETGKSLNVIMGGGRQMLNSLVPKTKWDLVDELLCESGDGRNLLKEWRSQKLRHSKIE
PIKFEVVQRTDELESLNATSFDYLMGVFANGDLSGNPRAPSLTLMVEKSLKVLKRNKQGY
FLLVEHFIKSGMDKRMQLELLNETLSNLQSEEDTLTLVLVTNAIYPKPSLDVSEETETIS
HLSEFFGEDEIEIQRRLYQMPTDSLVFAKGPKSSLFYGVQKETFLAHSLAYVLSRSKDG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgccaacgccacatcggactaaagaaatctgtcgagccgtgaggctgaaatctacgcag
gtcttcattgtggccggaaccattttgataacagtcttagtgacattggtctgcattggt
cttactacgcgctacgaagtggagaacgaggtggccaatgtggcggatgtggattactgg
aaggacagggtctccgctgtacagaaagtttggtacgacaaaggcattgccgagctaaac
gaagccctccgaaaaccaaggggtccgctcttcccaaaaaacgttttgatatttatggtc
cagggtgtcggtggtggcgatttggcggcttatagattcccagtaattagtggaaatagc
caggggaataccaattttctttgggacacattttcccacgtggctcgattgaaaaatagc
tgcagtcagcagtcaccctgccaggtgggaagcgtttcgcgagctttatggtctggaata
cctctggatgtgtcacttggaggggagtcggattgttggattgccgataaccagactgat
aactttctgagtgttgtgcgtcaggcccagttggctggcttgcgaacgggctttgtgact
gaccaaaggatcacaggaaccacaggagctgctctctacgggaacagtaaatatgagtgc
gacgaaagaatgccagtcggatcaattcagatgggatgtcaggacattgcccgccagttg
atttccggagaaaccgggaagtccctgaatgtgatcatgggcggtggtcgccaaatgctg
aatagtcttgtgccgaaaaccaaatgggatctagtggacgaattgctctgcgagtcaggt
gacgggcgcaaccttctcaaggagtggagatcgcaaaaactcagacacagcaaaatcgaa
cccataaagttcgaagttgtccagagaactgatgaactggaatctttgaatgccactagt
tttgactaccttatgggtgtattcgcgaatggtgacttgagtggaaacccaagagcccct
agtcttacgctaatggtggaaaaatcgttgaaagttctaaaaagaaataagcagggatac
tttcttcttgtggagcactttattaagtctgggatggataagcgaatgcaactggaactt
ttaaatgaaactttgagcaatcttcagtcagaagaggataccctaactttagtccttgta
accaacgccatctatccaaaacctagcctggatgtcagcgaggagacggagacaatcagt
catttgtcagaattcttcggagaagatgaaatagaaatccaaaggaggctttatcaaatg
ccaacggacagtttggtgtttgccaaaggacccaagtcttctttgttttatggagttcaa
aaagagaccttcttggcacattctttggcttatgttcttagcagaagtaaggatggttaa

DBGET integrated database retrieval system