KEGG   Drosophila ananassae: Dana_GF17135Help
Entry
Dana_GF17135      CDS       T01059                                 

Definition
GF17135 gene product from transcript GF17135-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dan  Drosophila ananassae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dana_GF17135
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dana_GF17135
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dana_GF17135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 479 aa AA seqDB search
MPTPHRTKEICRAVRLKSTQVFIVAGTILITVLVTLVCIGLTTRYEVENEVANVADVDYW
KDRVSAVQKVWYDKGIAELNEALRKPRGPLFPKNVLIFMVQGVGGGDLAAYRFPVISGNS
QGNTNFLWDTFSHVARLKNSCSQQSPCQVGSVSRALWSGIPLDVSLGGESDCWIADNQTD
NFLSVVRQAQLAGLRTGFVTDQRITGTTGAALYGNSKYECDERMPVGSIQMGCQDIARQL
ISGETGKSLNVIMGGGRQMLNSLVPKTKWDLVDELLCESGDGRNLLKEWRSQKLRHSKIE
PIKFEVVQRTDELESLNATSFDYLMGVFANGDLSGNPRAPSLTLMVEKSLKVLKRNKQGY
FLLVEHFIKSGMDKRMQLELLNETLSNLQSEEDTLTLVLVTNAIYPKPSLDVSEETETIS
HLSEFFGEDEIEIQRRLYQMPTDSLVFAKGPKSSLFYGVQKETFLAHSLAYVLSRSKDG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgccaacgccacatcggactaaagaaatctgtcgagccgtgaggctgaaatctacgcag
gtcttcattgtggccggaaccattttgataacagtcttagtgacattggtctgcattggt
cttactacgcgctacgaagtggagaacgaggtggccaatgtggcggatgtggattactgg
aaggacagggtctccgctgtacagaaagtttggtacgacaaaggcattgccgagctaaac
gaagccctccgaaaaccaaggggtccgctcttcccaaaaaacgttttgatatttatggtc
cagggtgtcggtggtggcgatttggcggcttatagattcccagtaattagtggaaatagc
caggggaataccaattttctttgggacacattttcccacgtggctcgattgaaaaatagc
tgcagtcagcagtcaccctgccaggtgggaagcgtttcgcgagctttatggtctggaata
cctctggatgtgtcacttggaggggagtcggattgttggattgccgataaccagactgat
aactttctgagtgttgtgcgtcaggcccagttggctggcttgcgaacgggctttgtgact
gaccaaaggatcacaggaaccacaggagctgctctctacgggaacagtaaatatgagtgc
gacgaaagaatgccagtcggatcaattcagatgggatgtcaggacattgcccgccagttg
atttccggagaaaccgggaagtccctgaatgtgatcatgggcggtggtcgccaaatgctg
aatagtcttgtgccgaaaaccaaatgggatctagtggacgaattgctctgcgagtcaggt
gacgggcgcaaccttctcaaggagtggagatcgcaaaaactcagacacagcaaaatcgaa
cccataaagttcgaagttgtccagagaactgatgaactggaatctttgaatgccactagt
tttgactaccttatgggtgtattcgcgaatggtgacttgagtggaaacccaagagcccct
agtcttacgctaatggtggaaaaatcgttgaaagttctaaaaagaaataagcagggatac
tttcttcttgtggagcactttattaagtctgggatggataagcgaatgcaactggaactt
ttaaatgaaactttgagcaatcttcagtcagaagaggataccctaactttagtccttgta
accaacgccatctatccaaaacctagcctggatgtcagcgaggagacggagacaatcagt
catttgtcagaattcttcggagaagatgaaatagaaatccaaaggaggctttatcaaatg
ccaacggacagtttggtgtttgccaaaggacccaagtcttctttgttttatggagttcaa
aaagagaccttcttggcacattctttggcttatgttcttagcagaagtaaggatggttaa

DBGET integrated database retrieval system