KEGG   Drosophila ananassae: Dana_GF17161Help
Entry
Dana_GF17161      CDS       T01059                                 

Definition
GF17161 gene product from transcript GF17161-RA
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
dan  Drosophila ananassae
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dana_GF17161
Enzymes [BR:dan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Dana_GF17161
Glycosyltransferases [BR:dan01003]
 Polysaccharide
  Storage polysaccharide
   Dana_GF17161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 709 aa AA seqDB search
MRRQQSYRFEDQESTSYALRMNRRFSRVESGADLKDYFDRGDIASRENRWNFEVAWEVAN
KVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEMEEMEFPRGNPLLDAVNALRSR
GYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKNEMWEKCNIGIPHLDIETNDAIILGFM
IAEFLEEFRNCAVSYSQNNGLSAPRIVAHFHEWQAGVGLIVLRTRQVEIATVFTTHATLL
GRYLCAGNTDFYNNLDKFAVDEEAGKRQIYHRYCLERGATHLPHVFTTVSEITGYEAEHL
LKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHMDFDLDKTLYFFIA
GRYEFGNKGADIFIESLARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQL
RDTINNVQQAVGKRMFDTCLKGHIPNADDLLQKDDLVKIKRCLFAMQRDSMPPVTTHNVS
DDWNDPVLASIRRCHLFNSVHDRVKMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYY
EPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHISDPKSYGIYIVDRRYIGLENSVQQLSS
FMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDYVDELTLYGS
RNNLIFSRPHSEPPSPTSSRHTTPAPSVHGSDDEDSVDEETELKELGIK
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagacaacagtcctatcgatttgaggatcaggagtccacctcctatgccctccgg
atgaatcgtcgcttttcaagagtagagtccggggcggacctgaaggattacttcgatcgg
ggggacatcgcctcccgggagaaccgatggaacttcgaggtggcctgggaggtggccaac
aaggtgggtggcatttacacggtgatccgatccaaggcctacgtgtccacggaggagatg
ggtgagcagctgtgcatgatgggaccctacaaggagcactgcgcccgcacagagatggag
gagatggagttccccaggggcaatcccctcctggatgccgtcaatgctctgcgatcgcgc
ggctacaaaatccacaccggacgctggctggtcgacggaaatcctcaactgatcctgttt
gacattggatccgctgcctggaagttggatcagttcaagaacgagatgtgggagaagtgc
aacattggaatcccccacctggatatcgagaccaacgacgccattatcctgggcttcatg
attgccgagttcctggaggagttccgcaactgtgccgtgtcctactcgcagaacaatggc
ctaagtgctccccgaatcgtcgcccacttccacgagtggcaggccggcgtgggtctgatt
gtgctgcgcactcgccaggtggagatagccaccgtgttcaccacccatgccacactgctg
ggtcgctatctgtgcgccggaaacactgacttctacaacaatctggacaagttcgctgtg
gacgaggaggctggcaagcgccagatctatcatcgctactgcctggagcgtggggccacc
cacttgcctcacgtgttcaccaccgtctcggagatcacgggctacgaggcggagcatctg
ctcaagcgcaagccggatatcatcacccccaacggcctgaacgtcaagaagttctcggcc
attcacgagttccagaatctgcacgccgtggccaaggagaagatcaatgagttcgtgcga
ggacacttctacggccacatggacttcgacttggacaagaccctgtacttcttcatcgcc
ggtcggtatgagttcggcaacaagggagccgacatcttcatcgagtccctggcccgtttg
aatgccatgctgaagcacgagaagcccgacaccactgtggtggccttcctcatcttcccc
accaagaccaacaactttaatgtggactcgctgcgcggtcatgcggtgatcaagcagctt
cgcgacaccatcaacaacgtccaacaggcggtgggcaagcgcatgttcgacacatgcctc
aagggtcacatccccaacgccgacgacctgctgcagaaggacgatctggtgaagatcaag
cgctgtttgttcgccatgcagcgcgattccatgccgccggtaaccactcacaatgtgtcc
gatgactggaacgatccggtgctggcctccatccgtcgctgccacttgttcaactcggtg
cacgatcgcgtcaagatggtcttccatccggagttccttacatccacaaacccattgttc
ggcatcgactatgaggagtttgtccgcggctgccatctgggagtcttcccctcgtactac
gagccctggggctacactccagcggagtgcacggtgatgggcattcccagtgtgaccacc
aatctgtccggtttcgggtgcttcatggaggagcacatcagcgaccccaagtcctatggc
atctatatcgttgaccgacgctacatcggcctggagaacagtgtccagcagctgtccagc
ttcatgatggagttctcgcgcctgaatcgccgccagcgcatcatccagcgcaaccgcacg
gagcgactgagcgacctgctcgactggcgcaccctgggcatttactacagacaggccagg
gttaaggccttgcaggccgtctatccggactacgtggacgagctgactctctacggatcg
cgcaacaatctgatcttctcgcggccgcacagtgaaccccccagccccacctcatcgcgt
cacactacgccagcaccttccgtacacggatctgatgatgaggactctgtggacgaggag
accgaactcaaggaattaggcattaaataa

DBGET integrated database retrieval system