KEGG   Drosophila ananassae: Dana_GF17270Help
Entry
Dana_GF17270      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
Organism
dan  Drosophila ananassae
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 6500055
NCBI-ProteinID: XP_001953310
FlyBase: FBgn0094288
UniProt: B3LZ19
Position
Unknown
AA seq 499 aa AA seqDB search
MRFRQDKKDKDRPGFEDNAAAAVAVAENNQLMLKDDDAGEGILAKATATERPAVQVKVTN
EVESAIGMRTMMTALVAGARMRNRGAAREKADYFDTQMARLSHLMSRQQPDRLPMWDGHN
LANNPSTAEQLLRLQPDYKLLYNADHHTYFHLHTLDPKAHLLQKKEKEEQAPHRRLFQQV
VGNTLTAAFGLNVMRKGETEAGEVITEKVNLYDAASLRRSRFNPFNPTRILIHGWLGNEN
ANMYSALLPAYFNLQNGNYNIFTVDWGRGAIADYITASYRVKPVGQVVAKFVDFLSQEAG
LRFEDLQLIGFSMGAHVAGLAGKNVQTGRLRMIRALDPALPFFRYAQEKERLTSQDADYV
EVLHTSVGSYGFDRPLGHVDFYANWGSQQPGCFWLECSHWRAFMLFAESLQLTGLQDSVF
LARGCPTSEWQQLTRLHRCSQGEGANETMGGDLANATAEFLARRRGVYYFPTNDQPPYAI
AVAVAVATQNVGPKGGTNK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttcgacaggataagaaggataaggacaggcccgggtttgaggacaatgccgct
gctgccgttgccgttgcagaaaacaatcaattgatgctgaaggatgatgatgctggcgaa
ggtatactggcgaaggcaacggcaactgaaagacccgcagtgcaagtaaaagtgacaaat
gaagtggaaagtgccatcggaatgagaacgatgatgactgcactggtggcaggggcaagg
atgagaaatcggggcgccgcgcgggagaaggctgactactttgacacacaaatggcacga
ctgtcccacctaatgagcagacagcaacccgatcggctgccaatgtgggatgggcataac
ctggccaacaatcccagcacggccgagcaattactccgcctacagccggactacaaattg
ctctacaatgccgaccatcatacctacttccacctgcacaccctggacccgaaggcgcac
ctccttcagaaaaaggagaaggaggagcaggctccgcatcgacgacttttccagcaggtt
gtgggcaacacactgaccgctgcctttggcctaaatgttatgaggaaaggggagacggaa
gcgggcgaggtcatcaccgaaaaggtgaatctctacgatgccgcttccctacgaaggtcc
cgctttaatcctttcaatcccactagaatccttattcatggctggctgggaaacgagaat
gccaatatgtacagcgccttgctgcccgcttactttaatctccagaatggtaactacaac
atcttcaccgtggactggggacgcggggccatagccgactacatcacggccagttatcgt
gtgaagccagtgggtcaggttgtggccaagtttgtggactttttgagccaggaggcggga
cttcgcttcgaggatctccagctgattggatttagcatgggagcccatgtggctggactg
gcgggtaagaatgtccaaaccggacgccttcggatgatccgggccttggatccagctttg
cccttcttccgctacgcccaggaaaaggaacggctcacctcgcaggatgccgactacgtg
gaagtcctgcacacgagtgtgggcagctatggcttcgatcgacctctggggcatgtggat
ttctatgcgaactggggcagccagcagccgggatgcttctggctagaatgtagccattgg
cgggctttcatgctctttgccgaaagccttcagttaacgggacttcaggactcagttttc
ctggcgcgtggatgcccaacctctgaatggcaacagctgacccgcttacaccgttgctcc
caaggcgagggggctaacgagaccatgggcggggatttggccaatgctactgcagagttc
ttggccagacggcgcggtgtctattattttccaacaaatgaccagccgccctatgctatt
gctgttgcagttgcagtggcaacacaaaatgttggcccaaagggtggcacaaataaataa

DBGET integrated database retrieval system