KEGG   Drosophila ananassae: Dana_GF17399Help
Entry
Dana_GF17399      CDS       T01059                                 

Definition
GF17399 gene product from transcript GF17399-RA
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
dan  Drosophila ananassae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dana_GF17399
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     Dana_GF17399
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 664 aa AA seqDB search
MASVRQNSQLYRPIPIPLHLHLPLVLVLSLHLHLSGVCGVIDRLVVQTTSGPVRGRSVTV
QGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRLSATCVQERYEYFPGFSGEE
IWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHSNGKQGDTDHLIHNGNPQNTTNGL
PILIWIYGGGFMTGSATLDIYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPAEFAEE
APGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGVVKRGM
MQSGTMNAPWSHMTSEKAVEIGKALINDCNCNVSMLKTNPAHVMSCMRSVDAKTISVQQW
NSYSGILSFPSAPTIDGAFLPADPMTLLQTADLKDYDILMGNVRDEGICKSMCHKPPLLG
TYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAIIFQYTSWEGNPGYQNQ
QQIGRAVGDHFFTCPTNEYAQALAERGASVHYYYFTHRTSTSLWGEWMGVLHGDEIEYFF
GQPLNNSLQYRPVERELGKRMLSSVIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKI
EKLARGPLAARCSFWNDYLPKVRSWAGTGCDGNSGSASTSPRLPILGIAALLYICAALRT
KGVF
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgttcggcagaacagccagctgtaccgccccatccctattcccctgcacctg
cacttgccgctggtgttggtgctgtcgctgcacctgcacctgtccggcgtctgcggcgtc
atcgaccgcctggtggtgcagacgacctccggcccggttcggggccgttcggtgacggtg
caggggcgcgaggtgcacgtctacacgggcatcccgtacgcgaagccgcccgtcgaggac
ctacgcttccggaagccggttccggcagagccatggcacggcgtactcgatgccacccgc
ctttccgccacctgcgtccaagagcgatatgagtactttccgggcttctccggcgaggag
atctggaaccccaacaccaacgtatctgaggactgcctctacataaatgtttgggctcct
gccaaggcacgtctccgacatgggcgcggtgccaacgggggtgagcactccaacggaaag
cagggggatacagaccacctcatccacaatggaaatcctcaaaacaccacaaacgggctc
ccaattttgatttggatctatggaggcggttttatgaccggatccgccaccctggacatc
tacaatgcggatattatggccgccgttggcaatgtgatagtggcttccttccaataccgt
gtgggcgcctttgggtttctgcatctggccccggagatgccggcagagtttgcggaggag
gcaccaggcaacgtgggtctttgggatcaagccctggccatccgctggctgaaggacaat
gcccatgcctttggcggtaatcccgaatggatgactctgtttggcgagtcggcgggttcc
agttccgtcaatgcccagctcatgtcgccggtgaccaggggcgtggtcaagaggggtatg
atgcagtctggcaccatgaacgcaccctggagccatatgacatccgagaaggccgtcgaa
atcggcaaggcccttatcaatgactgcaattgcaatgtctccatgcttaagaccaatccc
gctcatgttatgagttgcatgcgttcggtggacgccaagaccatatcggtgcagcagtgg
aattcgtactcgggcatcctcagctttccgtcggcgcctacaatcgacggagccttcctg
ccggccgatcccatgacgctgctgcaaacggcggacctcaaggactacgacatcctgatg
ggaaatgtcagggatgagggtatctgcaagtcgatgtgccacaaacctccacttttaggc
acttacttcttgctgtacgatttcatcgattacttcgataaggacgacgccacagccctg
ccgcgggataaataccttgaaataatgaacaacatttttggcaaggcaacgcaggcggaa
cgcgaggccatcatatttcagtacaccagctgggaaggcaacccgggctatcagaaccag
cagcagattggacgcgccgtgggcgatcactttttcacctgccccaccaacgagtacgcc
caggcattggcggagcgaggtgcctccgtgcactactactattttacacatcgcacaagc
acttcgttgtggggcgagtggatgggcgtcctgcacggcgatgagattgagtacttcttt
ggccagccgctgaacaactccttgcagtatcgacctgtggagcgggagctgggcaagcgt
atgctcagttcggtcatcgagtttgccaagacgggcaatccagctcaggatggcgaggaa
tggcccaacttctcgaaggaggatccagtctattacattttcagcacggacgataagatc
gagaaactagctcgaggtcctttggcggcccgctgctccttctggaacgattacttgccg
aaagtcaggagttgggcaggaactggctgcgatggaaactcgggaagtgcttccacatcc
cccagactgccgatcctaggaatcgccgccctgctctacatctgcgctgcattgcgaacc
aagggggttttctaa

DBGET integrated database retrieval system