KEGG   Drosophila ananassae: Dana_GF17399Help
Entry
Dana_GF17399      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
dan  Drosophila ananassae
Pathway
dan00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dana_GF17399
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     Dana_GF17399
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dan00537]
 Enzymes
  Dana_GF17399
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 GPS
Motif
Other DBs
NCBI-GeneID: 6500183
NCBI-ProteinID: XP_001953068
FlyBase: FBgn0094417
UniProt: B3LX51
Position
Unknown
AA seq 651 aa AA seqDB search
MASVRQNSQLYRPIPIPLHLHLPLVLVLSLHLHLSGVCGVIDRLVVQTTSGPVRGRSVTV
QGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRLSATCVQERYEYFPGFSGEE
IWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHSNGKQGDTDHLIHNGNPQNTTNGL
PILIWIYGGGFMTGSATLDIYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPAEFAEE
APGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGVVKRGM
MQSGTMNAPWSHMTSEKAVEIGKALINDCNCNVSMLKTNPAHVMSCMRSVDAKTISVQQW
NSYSGILSFPSAPTIDGAFLPADPMTLLQTADLKDYDILMGNVRDEGTYFLLYDFIDYFD
KDDATALPRDKYLEIMNNIFGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRAVGDHFFT
CPTNEYAQALAERGASVHYYYFTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPV
ERELGKRMLSSVIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCS
FWNDYLPKVRSWAGTGCDGNSGSASTSPRLPILGIAALLYICAALRTKGVF
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgttcggcagaacagccagctgtaccgccccatccctattcccctgcacctg
cacttgccgctggtgttggtgctgtcgctgcacctgcacctgtccggcgtctgcggcgtc
atcgaccgcctggtggtgcagacgacctccggcccggttcggggccgttcggtgacggtg
caggggcgcgaggtgcacgtctacacgggcatcccgtacgcgaagccgcccgtcgaggac
ctacgcttccggaagccggttccggcagagccatggcacggcgtactcgatgccacccgc
ctttccgccacctgcgtccaagagcgatatgagtactttccgggcttctccggcgaggag
atctggaaccccaacaccaacgtatctgaggactgcctctacataaatgtttgggctcct
gccaaggcacgtctccgacatgggcgcggtgccaacgggggtgagcactccaacggaaag
cagggggatacagaccacctcatccacaatggaaatcctcaaaacaccacaaacgggctc
ccaattttgatttggatctatggaggcggttttatgaccggatccgccaccctggacatc
tacaatgcggatattatggccgccgttggcaatgtgatagtggcttccttccaataccgt
gtgggcgcctttgggtttctgcatctggccccggagatgccggcagagtttgcggaggag
gcaccaggcaacgtgggtctttgggatcaagccctggccatccgctggctgaaggacaat
gcccatgcctttggcggtaatcccgaatggatgactctgtttggcgagtcggcgggttcc
agttccgtcaatgcccagctcatgtcgccggtgaccaggggcgtggtcaagaggggtatg
atgcagtctggcaccatgaacgcaccctggagccatatgacatccgagaaggccgtcgaa
atcggcaaggcccttatcaatgactgcaattgcaatgtctccatgcttaagaccaatccc
gctcatgttatgagttgcatgcgttcggtggacgccaagaccatatcggtgcagcagtgg
aattcgtactcgggcatcctcagctttccgtcggcgcctacaatcgacggagccttcctg
ccggccgatcccatgacgctgctgcaaacggcggacctcaaggactacgacatcctgatg
ggaaatgtcagggatgagggcacttacttcttgctgtacgatttcatcgattacttcgat
aaggacgacgccacagccctgccgcgggataaataccttgaaataatgaacaacattttt
ggcaaggcaacgcaggcggaacgcgaggccatcatatttcagtacaccagctgggaaggc
aacccgggctatcagaaccagcagcagattggacgcgccgtgggcgatcactttttcacc
tgccccaccaacgagtacgcccaggcattggcggagcgaggtgcctccgtgcactactac
tattttacacatcgcacaagcacttcgttgtggggcgagtggatgggcgtcctgcacggc
gatgagattgagtacttctttggccagccgctgaacaactccttgcagtatcgacctgtg
gagcgggagctgggcaagcgtatgctcagttcggtcatcgagtttgccaagacgggcaat
ccagctcaggatggcgaggaatggcccaacttctcgaaggaggatccagtctattacatt
ttcagcacggacgataagatcgagaaactagctcgaggtcctttggcggcccgctgctcc
ttctggaacgattacttgccgaaagtcaggagttgggcaggaactggctgcgatggaaac
tcgggaagtgcttccacatcccccagactgccgatcctaggaatcgccgccctgctctac
atctgcgctgcattgcgaaccaagggggttttctaa

DBGET integrated database retrieval system