KEGG   Drosophila ananassae: Dana_GF17404Help
Entry
Dana_GF17404      CDS       T01059                                 

Definition
GF17404 gene product from transcript GF17404-RA
Orthology
K17610  
calcineurin B homologous protein 1
Organism
dan  Drosophila ananassae
Brite
Protein phosphatases and associated proteins [BR:dan01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dana_GF17404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 189 aa AA seqDB search
MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAIN
PLCERIVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDD
DGVISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVD
QKMSIRFLN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggcaataaatcttcgctgttcctgcgtaacgaggaaatcgctcaaatccaggaggaa
actggctttacccccaaccaaatcgagcgactgtactcccgtttcacttccctggatcgc
aacgactgcggcactttgtcccgggaggaccttatgcgcattcctgagctggcgatcaac
ccgttgtgcgagaggatagtgcactccttcttcgcggaaagcaatgacgaccgggtcaac
ttccggcagtttatgaacgtcctggcccatttccgaccgctgagggacaacaagcagagc
aagctgaacagccgcgaggagaagctgaagttcgcctttaagatgtacgatctggacgat
gatggtgtgatcagtcgggacgagctgctctccattctgcatatgatggtgggggcgaac
atcagccaggaccagttggtgagcattgccgagaggacgattctggaggcggatttgtgt
tgccagggcaagatctcgttcgaggacttctgcaaggcgctggaccgcaccgatgtcgac
cagaagatgtccatcaggtttctcaactaa

DBGET integrated database retrieval system