KEGG   Drosophila ananassae: Dana_GF17480Help
Entry
Dana_GF17480      CDS       T01059                                 

Definition
GF17480 gene product from transcript GF17480-RA
Orthology
K08669  
HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     Dana_GF17480
Peptidases [BR:dan01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dana_GF17480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 426 aa AA seqDB search
MALRGSHRLDDFIRRCSALTLFHSQAPSRRVSHCGRDRRQQQDPPGQGRQEQQESGGGHW
SRFGWRSLIRFFVPFSLGAVASSLVIKREELTPTITAKAMSGRRRDFNFIADVVAGCADS
VVYIEIKDTRHFDYFSGQPITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRT
FPATIEDVDQTSDLATLRIQVSNLSVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVIS
STQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPID
YVKVFLERAAERRKKGAAYKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPSNLTHGVL
VWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALADNSKHLDIVILRGVKQMHVT
ITPEDP
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcactgcgcggttcccaccggctggacgatttcatccggcgctgcagtgcgctcacc
ctgttccacagtcaggctcccagccggagagtgagccactgcggcagggatcggcggcaa
cagcaggacccgccgggacagggccgtcaggagcagcaggagagcggcggcggacactgg
agcaggttcggctggcgcagtctgatccgtttcttcgtgcccttctctctcggggcggtg
gccagctcgctggtcatcaagcgggaggagctgacgcccacgatcacggccaaggcgatg
agcggccgccggcgggacttcaacttcatagcggacgtggtggctggctgcgcggactcc
gtggtctacatagagatcaaggacacgcggcacttcgactacttcagcggccagcccatc
acggcctccaacggctctggcttcatcatcgagcagaacggcctgatcctcacgaacgcc
cacgtggtaatcaacaagccgcacacgatggtccaggtgcgactctccgacggcaggacc
ttccccgccaccatcgaggacgtggaccagacctccgacctggcgaccctccgaatccag
gtgagcaacctgtcggtgatgcgcctgggcaagagcagcacgctgcgctccggcgagtgg
gtggtggccctgggcagcccgctggccctaagtaacacggtcacggccggagtaataagt
tccacgcagcgagcgtcgcaggaactcggcctgcggaatcgggacatcaactacttgcag
acggacgcggccatcacgttcggcaactccggggggccgctggtcaacctggatggcgag
gccattggcgtgaactcgatgaaggtgacggccggcatcagcttcgccattcccatcgac
tatgtgaaggtgttcctggagcgggcggccgagcgccggaagaagggcgccgcctacaag
accggctatccggtgaagcgctacatgggcataaccatgctgaccctgacgccggacatc
ctgttcgagctgaagtcgcggagtcagaacatgcccagcaacctcacccacggggtgctg
gtgtggaaggtgattgtgggctccccggcgcacagtggcggcctccagcccggcgacatc
gtgacccacataaacaagaaggagatcaagaactcctcagacgtctacgacgctctggcc
gacaacagcaagcacctggacattgtgatcctgcgcggggtgaagcaaatgcacgtaacc
atcactccggaggatccctaa

DBGET integrated database retrieval system