KEGG   Drosophila ananassae: Dana_GF17480Help
Entry
Dana_GF17480      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K08669  HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
dan  Drosophila ananassae
Pathway
dan04214  Apoptosis - fly
dan04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dan00001]
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dana_GF17480
   04215 Apoptosis - multiple species
    Dana_GF17480
Enzymes [BR:dan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     Dana_GF17480
Peptidases [BR:dan01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dana_GF17480
Chaperones and folding catalysts [BR:dan03110]
 Other chaperones and cochaperones
  DegP / HtrA
   Dana_GF17480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin_2 Trypsin PDZ_2 Peptidase_S46 PDZ Tricorn_PDZ Hjc
Motif
Other DBs
NCBI-GeneID: 6500264
NCBI-ProteinID: XP_001952912
FlyBase: FBgn0094498
UniProt: B3LVG7
Position
Unknown
AA seq 426 aa AA seqDB search
MALRGSHRLDDFIRRCSALTLFHSQAPSRRVSHCGRDRRQQQDPPGQGRQEQQESGGGHW
SRFGWRSLIRFFVPFSLGAVASSLVIKREELTPTITAKAMSGRRRDFNFIADVVAGCADS
VVYIEIKDTRHFDYFSGQPITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRT
FPATIEDVDQTSDLATLRIQVSNLSVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVIS
STQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPID
YVKVFLERAAERRKKGAAYKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPSNLTHGVL
VWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALADNSKHLDIVILRGVKQMHVT
ITPEDP
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcactgcgcggttcccaccggctggacgatttcatccggcgctgcagtgcgctcacc
ctgttccacagtcaggctcccagccggagagtgagccactgcggcagggatcggcggcaa
cagcaggacccgccgggacagggccgtcaggagcagcaggagagcggcggcggacactgg
agcaggttcggctggcgcagtctgatccgtttcttcgtgcccttctctctcggggcggtg
gccagctcgctggtcatcaagcgggaggagctgacgcccacgatcacggccaaggcgatg
agcggccgccggcgggacttcaacttcatagcggacgtggtggctggctgcgcggactcc
gtggtctacatagagatcaaggacacgcggcacttcgactacttcagcggccagcccatc
acggcctccaacggctctggcttcatcatcgagcagaacggcctgatcctcacgaacgcc
cacgtggtaatcaacaagccgcacacgatggtccaggtgcgactctccgacggcaggacc
ttccccgccaccatcgaggacgtggaccagacctccgacctggcgaccctccgaatccag
gtgagcaacctgtcggtgatgcgcctgggcaagagcagcacgctgcgctccggcgagtgg
gtggtggccctgggcagcccgctggccctaagtaacacggtcacggccggagtaataagt
tccacgcagcgagcgtcgcaggaactcggcctgcggaatcgggacatcaactacttgcag
acggacgcggccatcacgttcggcaactccggggggccgctggtcaacctggatggcgag
gccattggcgtgaactcgatgaaggtgacggccggcatcagcttcgccattcccatcgac
tatgtgaaggtgttcctggagcgggcggccgagcgccggaagaagggcgccgcctacaag
accggctatccggtgaagcgctacatgggcataaccatgctgaccctgacgccggacatc
ctgttcgagctgaagtcgcggagtcagaacatgcccagcaacctcacccacggggtgctg
gtgtggaaggtgattgtgggctccccggcgcacagtggcggcctccagcccggcgacatc
gtgacccacataaacaagaaggagatcaagaactcctcagacgtctacgacgctctggcc
gacaacagcaagcacctggacattgtgatcctgcgcggggtgaagcaaatgcacgtaacc
atcactccggaggatccctaa

DBGET integrated database retrieval system