KEGG   Drosophila ananassae: Dana_GF17531Help
Entry
Dana_GF17531      CDS       T01059                                 

Definition
GF17531 gene product from transcript GF17531-RA
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     Dana_GF17531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 332 aa AA seqDB search
MSCNYAEGLSAYDNKGILGAPETFDSDEEVSSKCRQLAEWIRQSGHVVLHTGAGISTSAG
IPDFRGPRGVWTLEEKGEKPEFNVSFDEAKPTKTHMAILALVASGHVQYVVSQNIDGLHL
KSGLDRRNLSELHGNIYIEQCKKCRRQFVRSSAVETVGQKSLKRPCKSSTDAQGRSCRAG
ILYDNVLDWEHDLPEKDLEMAVMHSTVADLNIALGTTLQIVPSGDLPLKNLKLGGKLVIC
NLQPTKHNKKANLIVCGYVDVVLSKVCKLLGVEIPEYSESSDPTKQLNPAEWTIAVKNVN
SFHKEYRAKVKDSKIEAKHEPKAKKTKSQYSN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtaactacgcggagggcctttctgcgtatgacaacaaggggatcctgggagcc
cccgagacattcgactcggacgaggaggtctcctccaaatgccggcaactggccgaatgg
ataagacaatcgggtcatgtggttctgcacacgggagcgggaatcagtacgtcagcggga
atacccgacttcaggggaccacgaggcgtttggaccctggaggagaagggcgaaaaacca
gagttcaacgtttccttcgacgaggcgaagccgaccaagacccacatggctattctcgcc
ctggtggcaagtggccacgtccagtacgttgtctcgcaaaacatcgacggactgcacctg
aagtcgggtctggacaggcggaatctttccgagttgcacggcaacatctacatcgagcag
tgcaagaagtgtcggcgccaatttgttaggtcctcggcggtggaaaccgtcggtcagaaa
tctctgaaacggccctgcaagtcttccacagacgcccaggggcgaagctgccgagcggga
atcctgtacgacaacgtattggactgggaacacgatctgccggagaaggacctcgaaatg
gctgtgatgcactctaccgtggccgatctgaacatcgccctgggcaccaccctgcaaatc
gtccccagcggggatcttccattgaaaaacctcaagcttggcggaaaactagtcatttgt
aatctccagcctacgaaacacaataaaaaagcaaatctcatagtttgtggctatgtggac
gtggtcttgtcgaaggtctgcaaattattgggcgtggagattcccgagtattcagagtct
tccgatcccaccaaacagctgaaccccgctgagtggactatcgctgtgaaaaatgtgaat
agcttccacaaggagtatagggctaaggtgaaggactctaaaatagaagccaaacacgaa
cctaaggctaagaaaactaaatcccagtattctaactaa

DBGET integrated database retrieval system