KEGG   Drosophila ananassae: Dana_GF17588Help
Entry
Dana_GF17588      CDS       T01059                                 

Definition
GF17588 gene product from transcript GF17588-RA
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dan  Drosophila ananassae
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dan01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dan01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 417 aa AA seqDB search
MTPNIIGSTFILAETTIADGNNNKMAAKPSATATAAPSAASSTTPTQKASKKLETVAESK
QPAAKPYKMEIVWLNVGLFIILHSMALYGLYLIFAENAYLELLPVYVTMFIGGLGITAGV
HRLWSHKAYKAKLPLRIFLMLCQSLAFQNSIWEWTRDHRVHHKFTDTHADPHNSRRGFFF
AHMGWLMCKKHPDVTSKGKQISMEDIEQDPVVMFQKKYYFVVMPICCFVLPMIFPYYVMG
SSLRVCFFTCSMLRFCLSLHFTWLVNSAAHFYGMKPYDVNVSAMNNKLVSTLTIGEGWHN
YHHVFPWDYKAAELGTYSFNWSTAFIDLMAKIGQAYDLKFVSQEMVYKRVLRTGDGSHVA
ALLDANNNNAMPTSELVAHLDHDLEEHAIWGWDDKDISEEDRKGANVVNKESECKQD
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgacacccaacataataggaagcactttcatattagccgagacgaccattgccgatggc
aacaacaacaagatggccgccaaaccttccgctaccgccactgctgccccttctgccgcc
tcctcgaccacgcccacccaaaaggcctcgaagaaactggaaacggtggccgaatccaag
cagcctgctgccaagccctacaaaatggagatcgtctggctcaacgtgggtctcttcatc
atccttcactcgatggccttgtatggactgtacctgatcttcgccgagaatgcatatctg
gagctcttgcctgtttacgtcaccatgttcattggcggtttgggcatcacggctggagtc
catcgtctgtggtcgcataaggcctacaaagcaaagctgcctctccgcatcttcctcatg
ctgtgccagtcgctggccttccagaacagcatctgggagtggacccgtgatcaccgtgtc
caccacaagttcaccgacacacacgccgatccccacaactcccgtcgcggtttctttttc
gcccacatgggatggctgatgtgcaagaagcaccccgacgtgacctccaagggcaagcag
atttccatggaggacattgagcaggatcccgttgttatgttccagaagaaatactacttt
gttgtgatgcctatctgctgcttcgttctgcccatgatcttcccctactatgtgatgggt
agctccctccgcgtgtgcttcttcacctgctccatgctccggttctgcctgtcgttgcac
ttcacctggctggtgaacagcgccgcccacttctatggcatgaagccctacgacgtgaac
gtcagtgcgatgaacaacaagctggtgtccactttgaccatcggcgagggatggcacaac
taccaccacgtcttcccctgggactacaaggcagctgagcttggaacctacagcttcaac
tggtcaactgccttcattgatctgatggccaagatcggacaagcctacgacctgaagttt
gtgtcccaggagatggtctacaagcgagtgctccgcactggcgatggctctcatgtcgcc
gccttgctggatgccaataacaacaacgccatgcccaccagcgaactggtggctcatttg
gatcacgacctggaggagcacgccatctggggctgggacgacaaggatatcagcgaggag
gaccgcaagggtgccaatgtggtaaacaaggagtccgagtgcaaacaggactag

DBGET integrated database retrieval system