KEGG   Drosophila ananassae: Dana_GF17707Help
Entry
Dana_GF17707      CDS       T01059                                 

Definition
GF17707 gene product from transcript GF17707-RA
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 438 aa AA seqDB search
MTDRRVSYFYNADVGNFHYGAGHPMKPQRLAVTHSLVMNYGLHKKMKIYRPYKASAQDML
RFHSDEYIAYLQQVTPQNIQCNSVAYTKYLAHFSVGEDCPVFDGLFDFCAMYTGASLEGA
QKLNHNHSDICINWSGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDVHHGD
GVQEAFYLTDRVMTASFHKYGNYFFPGTGDMYEIGAESGRYYSVNVPLKEGIDDQSYFQV
FKPIISAIMDFYRPTAIVLQCGADSLAGDRLGCFSLSTRGHGECVKFVKELNVPTLVVGG
GGYTLRNVARCWTHETSLLVDQDIANDIPATEYYDFFAPDFTLHPEINSRQDNANSKQYL
ELIVKHVYENLKMCQHSPSVQMVQTPPDVDLEELRNNKNEEADPDVRMSQADDDKMVEAK
NEFYDGDQDQDKPDSAES
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacggacagaagagtctcctacttctacaatgcggatgtgggcaacttccactacggg
gcgggccatccgatgaagccgcagcgcctggcggtgacgcacagcctggtgatgaattat
ggccttcacaaaaagatgaagatatacaggccatacaaagccagtgctcaggatatgctc
cgattccacagcgacgagtacatcgcatatctccagcaggtgaccccgcagaacattcag
tgtaattccgtggcctacaccaagtacctggcgcacttcagcgttggcgaagactgtccc
gttttcgacggcctatttgacttctgcgccatgtacactggcgcctcgctggagggagcc
cagaagttgaaccataaccacagcgatatctgcatcaactggtcaggtggcttgcatcat
gccaagaagtttgaggccagcggattctgctacgtaaacgacatcgtgataggcatcttg
gagctgttgaagtaccatccccgggttctctacatcgacatcgacgtgcatcacggcgat
ggagtgcaggaggccttctacctcacagaccgtgttatgacagcctcattccacaaatac
ggcaactacttcttcccgggaacgggcgacatgtacgagattggcgctgagtcgggccgc
tactacagcgtgaacgtccctcttaaagaaggaatcgatgatcagagctacttccaggtg
tttaaacccattatttcggccatcatggacttctatcgacctactgccattgtattgcag
tgcggagcagattccctggccggagatcgacttggttgcttctcgctgagcacgcggggc
catggggagtgtgtgaagttcgtcaaggagctgaatgtgcccactttagtcgttggggga
ggagggtataccctccgaaatgtggcccggtgttggacacacgaaacgtctctgttggtg
gaccaggacatcgccaacgatattccagcgacagagtattacgactttttcgcgccagac
tttaccctccatccggaaatcaactcgcgacaagataatgccaactcaaagcagtatctg
gagctgatcgtgaagcatgtctacgagaatctcaagatgtgccaacactcgcccagcgta
caaatggttcagacacctcccgacgtggacttggaagagctgcgcaataacaagaacgaa
gaggccgaccccgacgtacgcatgtcccaggcggatgacgacaaaatggttgaagctaag
aacgagttctacgacggggatcaggaccaagataagccggattcggcggagagttag

DBGET integrated database retrieval system