KEGG   Drosophila ananassae: Dana_GF17757Help
Entry
Dana_GF17757      CDS       T01059                                 

Definition
GF17757 gene product from transcript GF17757-RA
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dan  Drosophila ananassae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dana_GF17757
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Dana_GF17757
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 474 aa AA seqDB search
MTTAVLGGGLSGLSAGYYLLRRFGKPLTIYEAAPRVGGWVRSEFRKDRGFIFESGPRTIR
PVGVPGANTLELVEELQLDIKPITRSHVAARNRMLYAKGQLCMLPNSPKGLFGVMPPFTK
PLYKALLRDLVTQSTPAKLEDESIYSFAERRFGKEIADYAISPMICGICAGDAREISVRF
LMEGLFEKEQKYGGVLKGSLIARFKGKVDEGKEGLFAQGQPKLYSQAVQEKWAMYGLTGG
LEILPRTMRKYLGERDVNVQLSNECKNLTFGNSGVRMTVKDADVPVDHIVCSLPAHKLAP
LVKVQHPSLSAQLLDIPYVDVVVVNMQFQGQLLKQDGFGLLVPPVEKLPILGVIFDSCCF
DMGGNTVLTVMMGGHWFDKWFGDRPSQKQILDLATHHVQEILGIRDDPKFSRVHTLHKCI
PQYTVGHKRRVDNIRKYLKTYKLPLSLCGAAYDGVGINDVILSARRQVEALQLA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggctgtgctgggcggcggactaagcggcctctccgccggctactacctattg
cggcggtttggaaagccgctaaccatctacgaagcggctcctcgagtcggaggatgggtg
aggtcagaattccgtaaggatcggggttttatcttcgagagcggaccgcgtacaattcga
ccggttggtgttccgggggccaatacgttagagctggtcgaggagctgcagttggacatc
aagcccattacccgcagtcatgtggcagcccggaaccgaatgctgtacgccaaaggtcag
ctctgcatgttgcccaacagtccaaaaggtctcttcggagtcatgccgcccttcacaaag
ccattatacaaagcgcttctacgggacctagttacccaaagcacgccggccaagttggag
gacgaatccatatacagctttgcggaacgacgttttggaaaagagattgccgactacgcc
atcagtccaatgatctgtggaatctgcgccggcgatgctcgcgagatcagcgtacggttt
ctgatggaaggacttttcgagaaggagcaaaaatatggtggtgtgttgaagggatcgctt
attgcgcggtttaagggtaaggtagatgaaggaaaggaaggcctatttgcccagggtcag
cctaagctttactcccaggcggtgcaagaaaaatgggccatgtatggactgactggaggc
ttggagatactgccccgcacaatgaggaagtaccttggcgagagggatgtcaacgtacaa
ctgagtaacgagtgcaagaatttgacctttggaaactctggtgttcgaatgacagtcaag
gatgccgatgttcctgtggaccacatcgtctgttccttacccgcccacaaattggcgccc
ttggttaaggttcaacacccttcactttccgcgcaacttctggatattccctatgtggat
gtcgttgtagtaaacatgcagttccaaggacagctcctcaaacaagatggcttcgggttg
ctggttcccccagtagagaaactacccatcttaggagtcattttcgacagctgctgcttc
gacatgggaggtaacacagtgctaacggtcatgatgggcggccactggtttgataagtgg
tttggtgatcgtcccagtcagaagcaaattctggacctggccactcaccatgtgcaggaa
attcttggaattcgcgacgatcccaagttcagtcgtgtgcacaccctccacaagtgcata
ccacagtatacggttggccacaagcgccgtgtggacaacatcagaaagtacctaaagact
tacaaactgccactttccctttgcggtgccgcctacgatggagtaggaatcaacgatgtc
attctgtctgcccggcgtcaggtggaagcactgcaactagcctag

DBGET integrated database retrieval system