KEGG   Drosophila ananassae: Dana_GF17824Help
Entry
Dana_GF17824      CDS       T01059                                 

Definition
GF17824 gene product from transcript GF17824-RA
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 633 aa AA seqDB search
MDLNTPLPRRNKDLMAALDSDEDSNTPFNQKRSEARGAAMHIKDKLRGKENEPLSNMPME
MLPRRASELMMLDSDSEEDDNKSNQNLNCAILNDSFVLSPTHELTGSTGTISASRPSSAA
PLKQSDSNLSFLGRFGNMGLNCSGQKSPPAAQVTTKAPPPTIKSIAERRQLLDTETPLRK
GVTSTSSSVTAMKSQVKPEADFVTPQVRTIGSTQAGKSRVAVTNEFRSQKVLFQTPMTVS
RAAPFPSDSINFSLCDTISESPDIPEPKKEDPQSGKSKKSLDFSEVEKEKQVVQPKLETI
EPAKELISVPIVTADPKPSTQSIAKPSSTLKIKNHEYVIVKKLGCGGSSSVYLARRSDTG
EEFALKVVDLQADPQVVQGYLNETKLLAKLQGNACVVALYDYQLLREELKLYMVMEKGDC
DLNKILQNYTTNLPLYSLVNILYQMLQAVNYIHQNGVIHSDLKPANFLMVNGRLKLIDFG
IASNIAVDSTSIIKFSQAGTFNYISPEALTDTSTGNSPMRRGNQPKIKISTKSDVWSLGC
ILYLLIYQKTPFGHIRNVYAKMSAIASPATSIEYPALPPYYPDMLIQMVKKCLQLNPKRR
PSCTELLQYPFHMLIPLQNLQIPGRTTAAASNN
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggacttaaatacgcccctgccgcgacgtaacaaggatctgatggccgcattagattcc
gacgaagacagtaatacgcctttcaaccaaaaacgatcggaggctcggggagcggcaatg
cacattaaggataagctcaggggcaaggagaacgagccactttcgaatatgcccatggaa
atgctacctcgtcgagcttctgaactgatgatgctggactctgacagcgaagaggatgac
aacaagagtaatcagaaccttaactgcgccatcttaaacgactcctttgtgctgagccca
actcacgagcttacgggcagtaccggcaccatttccgcctctcgaccctcctctgccgct
cctctcaagcagtccgattcgaatctttcgtttctcggccggtttggtaacatgggcctc
aattgtagcggtcagaaatcccctccagcggctcaagtgactacgaaagcgccaccacct
acgataaaatccattgccgagagacggcaacttctagatactgagacgccgttgcgaaag
ggcgtcacctccacctcatcctccgtgactgctatgaagtcacaggttaagccggaggca
gactttgtaactccacaagttcgcacaataggatccacgcaggctggaaagagtcgggta
gctgtgaccaatgagtttcgctcccagaaggtacttttccagactcccatgactgtgagc
cgggctgctccttttcccagtgacagtattaatttctccttgtgcgatacgatcagtgaa
agtcccgacattccagagccgaaaaaggaagacccgcagagcggcaagtccaaaaagtct
ctggacttctcggaggttgaaaaggagaaacaagtagttcagcccaaactagagacaatc
gaaccggccaaagagctgatctcagtgcccatagtcacggctgatccgaagccatccacc
caatccattgcgaaaccatcaagcacactaaagattaagaaccacgagtatgtgattgtc
aagaagctgggatgcgggggctccagttctgtttatttagcccggcgatcggacaccggg
gaagagttcgctctgaaggtagtggatctgcaggccgatccccaagtggtgcagggctat
ctgaacgagaccaagcttctggctaagcttcagggaaacgcttgtgttgtggcgctctat
gattatcaactgctacgggaggagcttaaattgtacatggtaatggaaaagggcgactgc
gacctcaacaagatcctccaaaactacaccaccaacttgccgctatacagcttagtgaac
attctgtaccaaatgctgcaggctgtcaactacattcaccaaaacggggtaattcactcg
gatctgaagccagccaacttcttgatggtcaacgggcgattgaagctcattgatttcgga
attgccagcaacattgcggtggactcgacgagcatcattaagttttcgcaggccggcacc
ttcaactacattagtcctgaggcgttaacggacacctccacgggaaacagtccgatgcga
cggggtaatcagccaaagattaagatatccaccaagtcggatgtgtggtcgctgggctgc
atcctgtacctgcttatatatcagaagactcccttcggtcatatacgaaatgtctacgcc
aagatgagtgcaattgcgagtccggcaaccagcatagagtatcctgcactaccgccctac
tatccagatatgctgattcaaatggtcaagaaatgcctgcagttgaatcccaagaggcga
ccatcttgcactgaacttctgcagtatccattccatatgctcattccccttcagaacctc
cagatacccggcagaacaaccgccgccgcatccaacaactag

DBGET integrated database retrieval system