KEGG   Drosophila ananassae: Dana_GF17839Help
Entry
Dana_GF17839      CDS       T01059                                 

Definition
(RefSeq) GF17839 gene product from transcript GF17839-RA
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dana_GF17839
Protein kinases [BR:dan01001]
 Serine/threonine protein kinases: AGC group
  AUR family [OT]
   Dana_GF17839
Protein phosphatases and associated proteins [BR:dan01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dana_GF17839
Chromosome [BR:dan03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Dana_GF17839
   Spindle formation proteins
    Dana_GF17839
  Sister chromatid separation proteins
   Aurora kinases
    Dana_GF17839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 404 aa AA seqDB search
MSHPNNNVLRPKDNALSWKPENSSHVLGLQKKNLLLSKKPNSENLAPAASKPLPVTSNKP
GAGGTSVQAASTAPPAAPVFQKPLVPTVKKVPSEFVAPAPVAASKTEKPTTAAAASTSGA
TTSTEAEKGKTDTQPPKPKKTWQLSNFDIGRMLGRGKFGNVYLAREKESQFVVALKVLFK
RQIDESKVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIYLILEYAPQGTLFNALQAQP
LKRFDERQSATYIRSLCSALLYLHERDIIHRDIKPENLLLGHKGVLKIADFGWSVHEPNS
MRMTLCGTVDYLPPEMVQGKPHTKNVDLWSLGVLCYELLVGHAPFFSKTFDETYKKILKG
DYKLPEHVSKAAAHLISKLLVLNPLHRLPLDQVMVHPWILAHTQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatcccaacaacaatgtgctgcgccccaaggacaatgcactgtcctggaagcct
gaaaattcctctcatgtccttggcttgcagaagaaaaacttgctcctgtccaaaaagcca
aatagtgaaaacctggctcctgcagcaagcaagccacttccagtaaccagtaacaaaccc
ggagcaggaggaaccagcgttcaggcagcatctacagctccacctgctgctcctgtattc
caaaagccactggtgcccacagtgaagaaggtgccttccgaatttgtggctccagcccca
gttgcagcctctaagactgagaaacccaccacggctgccgccgcaagcacctccggagcc
acaacaagcactgaagcagagaaaggcaagactgatacccaacccccaaagccaaagaaa
acctggcagctaagcaactttgatatcggccgcatgctgggccgcggaaagttcggcaat
gtgtacttggcccgcgagaaggaatcccagtttgtggtggcattgaaagtgctcttcaag
cgtcaaatcgatgagtccaaagtggagcaccaggtgcgccgcgagatcgaaattcagtcg
catttgcgacatccgcacatccttcgcctctatgcctactttcatgatgatgttcgcatc
tatttgatactggagtacgccccacaaggcactctcttcaacgctctacaagctcagcct
ttaaaacgcttcgatgaacgccagtcggccacttacatacgctccttatgctcggctctg
ctttatctacacgaacgggacatcatccaccgagacatcaagccggagaaccttctgctg
ggccacaagggcgtcctcaagatcgccgacttcggctggtccgtacatgagcccaactcc
atgcgcatgacgctttgcggcacggtcgattatctgcctccggaaatggtgcagggcaag
ccccacaccaagaacgtcgacctctggagcctcggagtgctgtgctatgaactgctggtg
ggtcatgctcccttcttctccaagaccttcgacgagacctacaagaagatcctcaaggga
gactataagctgccggagcatgtctccaaagcggcggcccacttgatttcgaagcttctg
gtgctgaacccactgcatcgcctgccattagaccaggtgatggtgcacccctggatcctg
gcgcacacgcagtaa

DBGET integrated database retrieval system