KEGG   Drosophila ananassae: Dana_GF17845Help
Entry
Dana_GF17845      CDS       T01059                                 

Definition
GF17845 gene product from transcript GF17845-RA
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dana_GF17845
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     Dana_GF17845
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     Dana_GF17845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 601 aa AA seqDB search
MAERCCTCRKKEARVHVIFVGGTIGMTRNEKGELVCVPKIFCQRLNEFPTCNDKKYEVEH
FSALPLLPDLPYRVLYDVLEFNPLLDSSCMGIGDWQKIAKEVAKNMCSYDGFVILHGTDT
LAYTASALAFMLENLNKPVVVTGAQISIFDPRSDGRDNFLGSLLIAGNFNIPEVVVFFGN
KLMRGCRTTKVNSDSFHALDSPNLPPLGKMNVKVEINSRQIFRPCTVNRFSLFSDFEPNV
AMIRIYPGITASNLKESLKEPIKGAVLQTYGAGNFPRCREELLDELREAILREVIIVNIT
QCSAGMVSSAYATGSVLSEIGVISGYDMTQEAAFTKLAYVLAKPEWNLANKKKVLLLSLR
GELTTNKIPKINDIDLIEGVARTLHMSLDLEKEQMCSTFYPALVAAAVTQGDTQKMSDLK
QYGADLCDRNADGRTALHLACYLGKLNCVCYLISAGCPLNVQDRFNRTPLHEAIDTDNHE
VIQALLKNGAKLCDPPLVQAELLRALTERGKVKRLESFRLAGADVTLADRTGRTALHYAC
QLGIHEVVEYLLPYYKNPLLKDELGMSPMDYAKAANHEHIVTLLRYKENEKKNEDPCSCA
N
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggccgagagatgctgtacatgccgcaagaaagaggcccgtgtccatgtcatcttcgtg
ggaggaacaattggaatgacaagaaatgaaaaaggagaattggtttgtgtacccaaaatt
ttttgtcaacggcttaacgaattcccaacctgcaacgacaaaaaatatgaagtggaacat
ttctcagctttgccgctgcttccagatttgccatatcgtgttctttacgatgttcttgag
tttaatccattgttagattccagttgtatgggtataggggactggcagaagatagccaag
gaggtggccaaaaacatgtgttcttacgatggctttgttattcttcacggcacggatacc
cttgcatatacggcctctgcacttgcatttatgctggaaaacctgaataagcccgtagtg
gttacaggtgctcagatttcgatcttcgatccccggtccgacgggagggacaacttcttg
ggttccctcctcatcgccggtaatttcaacatacccgaagtggtggttttcttcggcaac
aagcttatgcgtggctgtcgcaccacaaaagtcaactctgactccttccacgccctcgac
tcgcccaatctgccaccgctgggaaagatgaatgttaaggttgagatcaatagtcgccaa
atcttccggccgtgtacggttaacaggttttcactgtttagcgatttcgaacctaatgta
gccatgattcgcatctatccgggaataacagcttccaatttaaaggaatctttgaaggaa
ccgattaagggagcggtacttcagacgtatggtgccggaaactttcctaggtgtcgcgag
gaattgttggatgagcttcgagaagctattctcagggaggtcatcattgtaaacatcacc
cagtgttccgctggcatggtcagctccgcttatgcgacgggctctgtgctgtcggaaata
ggtgtgatctcaggctatgatatgacccaggaggccgccttcaccaagctggcttatgtg
ttggccaaaccggaatggaatctggccaacaagaaaaaggtattattgctgagcctgcgc
ggcgagcttactaccaataagatacccaaaataaacgacatcgaccttatcgagggtgtg
gcccgcaccctgcacatgtctttggacttggagaaggagcaaatgtgttctacgttctat
ccagcattggtggccgccgccgttacccagggcgacacccaaaaaatgagcgatctcaag
cagtacggggcggatctgtgcgacaggaacgcggatgggcgcactgccctccacctggcc
tgttacctgggaaagctcaattgtgtgtgttatctaatatcagccgggtgtcccttgaac
gtgcaggatcgcttcaatcggactccgctccacgaggccattgacacggacaaccacgaa
gtcatccaggcactattaaagaacggagccaaactgtgtgatcctccgctggtgcaagcg
gagctgctgcgtgccctgaccgaacggggaaaagtgaagcgactggaatcgttccgactg
gccggggctgatgtgacgctagccgatcgcacaggtcgcacggcactgcactacgcctgc
cagttgggaatccacgaagtggtggagtacttgctaccgtactataagaatccgctgttg
aaagacgaactgggcatgtcccccatggactacgccaaggcggccaatcacgagcacatc
gtcaccctgctgcggtacaaggagaacgaaaagaagaacgaggatccgtgttcgtgtgct
aattaa

DBGET integrated database retrieval system