KEGG   Drosophila ananassae: Dana_GF17864Help
Entry
Dana_GF17864      CDS       T01059                                 

Definition
GF17864 gene product from transcript GF17864-RA
Orthology
K04437  
filamin
Organism
dan  Drosophila ananassae
Brite
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dana_GF17864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2546 aa AA seqDB search
MNVKTFSSRGQHAGVGVLFNGDSPKTKDAKAQQIGNRGAAATGIGEIVQNASYANGQTTQ
ATIFLNHNNRKNPPTPNHNQNSAGPCVYNNNSNSEFAPIPNFSNLNFYAQPPAAHYDVCY
QQPNEYYQQAQQQGQPADQYEENFDEDMEAERDLAEDAQWKKIQQNTFTRWANEHLKTID
RSINNLETDLSDGLRLIALIEVLSQKRMPKYNKRPTFRSQKLENVSVALKFLQDEGIKIV
NIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDEKQLNGSGHTPKQRLLNWIHAKI
PDLPINNFTNDWTTGKAVGALVDACAPGLCPDWEMWDAKDAVQNASEAMGLADDWLNVRQ
LIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYGPGIEPIGPVVGA
PANFTVETFSAGKGAVDVEIQGPNGEIEKADVRFNNDKNLTYTVSYIPKAEGPHKVGVKF
SGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILTKDAGRGVPEVII
IDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDA
RKVRASGRGLQATGVRVGDDADFKIYTEGAGEGLPEVRVIGPGGMNQNVMLSKVDGNTYE
CHYYPTKEGRYVIMVTFAGQEVPKSPFEIKVGPKKESSIVAYGPGLSSGVIGYPAAFVVE
TNGETGALGFTVAGPSQAEIECHDNGDGSALVKYLPTAVGEYAVHILCDNEDIPKSPFIA
QILPRTDFHPELVKSSGPGLEKNGVTINQPTSFTVDTSKAGNAPLDVVVQDVYGTKLPVE
LKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAARVQAFGPWLQPG
VHPNVPTHFNVDAREAGDAELKVKIVHEETKLEVPCRIIDNEDNTYSVEVIPPTKGAYTT
TMTYGGQRVPLGQKVVVEQTVDVSKIKVDGLEPTAPLNSLQQFRIITHGLPKADLAVTIT
SPSGNRVKAHIIPTAEGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQ
AFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEA
GDYTVNITFNERHINGSPFQPLIVPVPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSNVG
SNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSP
FVVNVKSGCDPSRCKAYGPGLETGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTD
NRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPTKVKVYGPGIEHGQVR
ESVPTYFNVDVAEAGPGRIAVKLTNSEGIPVDNLRVEDKGNSIYAVHYVPPKAGSVLTCQ
VKFSEVEVPCSPFVMTVFPKSEATKVKVKGVNEKKKTPASLPAEFEIDTKQAGQADINVA
IKNPKGKPMQPRLEEVASGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAK
KCKLVEQAPKIQPSGSQSHLKVDAREAGDGAVTCKITNKEGNEIVDIDVIEKDGFFDILY
ALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNG
KSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHE
LVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMA
VEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQ
ISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHL
VSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGNGLKEGQTHADNIFSVDTRNAGFGGL
SVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVSGEGSN
RKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLY
SVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGIVGEAAE
FNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPD
SPFKVYVSPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGELDAKIVAPSGTDDDC
FIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHATGNGLD
EVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVK
YNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKV
VSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPRGPCEEFHVKHAGHNNYNVQYLV
RDRGQYVLLIKWGEEHIPGSPFQIDV
NT seq 7641 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttaaaactttcagctctaggggacagcatgccggcgttggggttttatttaac
ggtgattcgccgaagactaaagacgccaaagcgcagcagatcgggaatcggggtgccgct
gctaccggaatcggtgaaatagtgcaaaacgcaagctacgcgaacggtcaaacgacacag
gcgacgatattcctcaaccataacaatagaaagaacccgccaactccgaaccacaatcaa
aacagcgccggcccgtgtgtttataacaacaatagcaatagcgaatttgcgccaattcca
aactttagcaatttgaatttctacgcccagccgccagcggcacactacgacgtttgctat
cagcagccgaacgagtactaccaacaggcacagcagcagggccagccggcggaccagtac
gaggagaacttcgacgaggacatggaggccgaacgggatctcgccgaggatgcgcaatgg
aagaagatccaacagaacaccttcacccggtgggccaacgagcacctgaagacgatagat
cggtcgatcaacaacctggagacggatctctccgacggcctccgactgatcgccctgatc
gaggtcctctcccagaagcgtatgcccaagtacaataaacgcccaacattccgcagccag
aaacttgaaaacgtctcggtggccctgaaattccttcaggatgagggaatcaaaatcgta
aacattgactcctcggacattgtggactgtaagctgaaactgatactgggcctgatttgg
acactgatcctccactactcgatatcgatgcccatgtgggatggcgaggacgagaagcag
ctgaacggatcgggccacacgcccaagcagcgcctgctcaactggatacacgccaagata
cccgacttgcccatcaataacttcaccaacgactggaccacgggcaaggctgtgggcgcc
ctcgtcgatgcctgtgccccgggcctgtgtcccgactgggagatgtgggatgccaaggat
gccgtccagaacgcttccgaggccatgggcctggccgatgactggctcaatgtgcgccag
ctgatcaagcccgaggagctggtgaaccccaatgtggatgagcagtcgatgatgacctat
ctgtcgcagtatcccaactctaagctcaagaccggagctccgctgaggcccaagaccaat
cccaacagagtgcgtgcctatggtccaggaattgaacccattggcccagtggtcggtgcc
ccagccaatttcacggtggaaaccttctccgccggcaaaggtgctgtggatgtggagatc
cagggacccaatggcgagatcgaaaaggctgatgtccgcttcaacaacgacaagaacctc
acctacaccgtctcgtacatacccaaggccgagggtcctcacaaggtgggcgtaaagttc
tccggacgcgacatccccaagtcgccgttccccgtcaaggtcgaaggacatgccggcgat
gcctccaaggttaaggttactggtcccggcatccagcccaacggagtgaccattaagaag
cctactttcttcgacatactcaccaaggatgcgggtcgtggtgtgcccgaggtgatcatc
atcgatccggccaaccacaagacctcggtggccgccaaggtgcgtcagctggagaatgat
acgtggcgttgcgagtacgtcactgctctgcagggtctgcattcggtaaacgtcttctac
gccggcacacccattccgaacagtccattcccggttaaggtggccccactgtcggatgcc
cgcaaggtgcgcgcttccggccgtggcctccaggccaccggagttcgtgtcggcgacgat
gcggacttcaagatctataccgagggtgctggcgagggtttgcccgaggtgcgcgtcatt
ggtcccggtggcatgaaccagaacgtgatgctgtcgaaggtggatggcaacacctacgaa
tgccactactatcccaccaaggagggtcgctacgtaatcatggtcacgtttgccggccag
gaagttcccaaatccccgttcgaaataaaggtgggccccaagaaggagtcctcgattgta
gcctatggccctggcctgagcagcggtgtcattggctacccggctgccttcgtggtggag
accaatggcgagacaggcgccctcgggttcaccgtggccggaccctcgcaggccgagatc
gagtgccacgacaacggcgatggatccgccctggtcaagtaccttccgaccgctgtcgga
gagtatgccgtccacatcctgtgcgacaacgaggacatccccaaatccccgtttattgcc
caaattctgccacgcaccgacttccaccccgagctggtcaagagcagtggcccggggctg
gagaagaatggcgttactatcaatcagcccaccagtttcaccgtagacaccagcaaggct
ggcaacgctcccttggatgtggtcgtccaggatgtgtacggcactaagctgcctgtggag
ctgaagaacaacccggacggcaccaagaaggttacttacacgcccacttccggagtcccc
cacaccgtcgaagttaactacggcggcgtctccactcccaattccccgcatcgcgtctac
gtcggcgtccctgtggatgcggccagggttcaggccttcggtccctggctacagcctgga
gtgcatcccaatgtacccacccatttcaatgtggacgcccgcgaggccggcgatgccgag
ctcaaggtgaagatcgttcatgaggagaccaagctcgaagtgccctgccgcatcatcgac
aacgaggacaacacctactccgtggaggttatcccgccaactaagggcgcctacaccaca
accatgacctacggcggccagagggttcctctgggacagaaggtcgtcgtggagcagaca
gtggatgtgtccaagatcaaggtggacggactcgagccgaccgcgcccctaaatagttta
cagcagttccggatcatcacacacggcctgcccaaggcggatctggccgtgacgataacc
agcccgtcgggcaatcgcgtcaaggcccacatcatacccacggctgagggcttcctggtc
aacttcacgcccacccagctgggcgagtatctgctgagcatttgctttggtggcacaccg
atcaccccacgacccttccggctgcagtgcctcacaggcagcgactccaacaaggtacag
gcctttggacctggattggagcggggaattgtgggccagccggcggagtttatgatcgac
acacggggtgccgggcaggggggactgggtgttaccgtggagggtccctgcgaggcagcc
attaactgccgggacaacggcgatggcacctgcaatgtggcctacctgccgaccgaggcg
ggtgactacaccgtcaatataaccttcaacgagcgccacatcaacgggtcgccattccag
ccgctgattgtcccggtgccgaacctgaagaacacccgggtcagcggcatcggcatccag
ccgcatggtgtgatcatgaacgccgccacggacttcatggtggacatgagcaatgtggga
agcaacattgactccggcaaactgtcctgcgccatcttcgatcccatgggccatgtcctg
cccagcaagatcgtccagggacccaccgacgacatcttccggatcatgtacacgcccttc
gaggccggtcgccacaccatcgaactgatgtacgacaatatcccggtgccgggatctccg
tttgtggtaaacgtgaagagcggctgcgatccgtcgcgttgcaaggcctacggacctggt
ctggagacgggcctgaccaaccagaagaacaagttcactgtggagacgaagggcgccgga
aacggcgggctctctctggccattgaagggccctcggaggccaagatgacctgcacggat
aatcgcgacggcagctgcgatgtggactacttggccacggatccgggcgagtacgatatc
accattcgctttgccgacaagcacatccccggctccccgttccgcgtgctcgtggaggag
acggtggatcccactaaggtgaaggtctatggacctggcattgagcacggccaggtgcgc
gagagcgtgccgacctacttcaatgtggatgtggccgaggctggtcccggccgcatcgcc
gtgaagctgaccaactccgagggcattcccgtggacaacttgcgggtggaggacaagggc
aacagcatttatgccgtgcattatgtgccgcccaaggcgggatccgttctcacatgtcaa
gttaagttctccgaagtcgaagtgccatgcagtccttttgtgatgaccgttttccccaaa
tcggaagccaccaaggtcaaggtcaagggcgtcaatgagaagaagaaaactcccgcctcc
ctgcccgccgaattcgagatcgacacaaaacaagccggccaggccgacatcaatgtggcc
atcaagaatccgaagggcaagccgatgcagccccgcctcgaggaagtggccagtggcacg
tacgtggtgtcctttgtgccggacgagtgcggaacgtaccaatgcagcatcaagtacggc
gacaaggagatcgaggggtcgcccttcaaactcgaagcattccccaccggcgaggccaag
aagtgcaagctggtggagcaggcgcccaagatccagccctcgggcagtcagtcgcacctg
aaggtggacgcccgtgaggccggagatggtgctgtgacctgcaagataaccaacaaggag
ggcaacgagattgtggacattgatgtgatcgagaaggacggcttcttcgatatcctgtac
gccctgaacgatcctggcgactacgacatcaatgtgaagtttggcggcaaggacataccg
aacggcagcttctccatcaaggctgtcgaaagtatcgaacaatattcgcatagtgagtac
atcgaggagcacacgaccaaggtggtgcagcaaacaacgcagagcgagcttgtgaacgga
aaatctgagatcacataccgaagtgttgccttcgaaaaattgccacttcccacgacaggc
ggtaacgtaacagctgaagtcagaatgccaagcggtaaggtagacaaacccgttattcag
gacaaccgtgacggtaccgtctcggtcaagtacgatccccgtgaggagggatcccacgag
ctggtggtcaaatacaatggagagcccgtccaaggttctcccttcaaattccacgttgac
tcgatcacctccggctatgtgactgcttacggacctggtttgacccatggtgtgaccggc
gagccggccaacttcaccatctccaccaagggagccagcgccggtggcctgaccatggcc
gtcgaaggacccagcaaggcggacatcaactaccatgataacaaagatggcaccgtgtcc
gtgcaatacctgcccactgcccccggcgagtaccaggtgtcggttcgcttcggcgacaag
cacatcaagggatcgccctactttgccaagatcaccggtgagggacgcaagcgcaaccag
atctcggtcggttcctgctccgaggtgaccatgcccggcgacatcaccgacgatgatctg
cgcgccctgaacgcttccatccaggctcctagtggcctggaggagccgtgcttcctgaag
cgcatgcccaccggaaacattggcatctcgttcacgccccgcgagatcggcgagcacttg
gtgtcggttaagcgcctgggaaagcacatcaacaactctcccttcaaggtcaccgtttgc
gagcgtgaggtgggcgatgccaagaaggtcaaggtcagcggtaacggcctgaaggagggt
cagacccatgccgacaacatcttctccgtggacacacgcaacgccggattcggtggtctt
tccgtctcgatcgagggtcccagcaaggctgagatccagtgcacggacaaggacgacggc
actctcaacatctcctacaagcccacggagccaggttactacattgtcaacctgaagttc
gctgatcaccacgtggagggatccccattcaccgtcaaggtatctggagagggcagcaac
cgcaagcgcgagaagatccagcgtgagcgggatgccgtccccatcacggaaatcggcagc
cagtgcaaactgaccttcaagatgcccggcatcacctccttcgacttggccgcctgtgtc
acctcacccagcaacgtgactgaggatgccgagatccaggaggtagaggatggcctctac
tcggtgcactttgtgcccaaggaactgggcgtgcacaccgtctcggtgcgctactctgag
atgcacatacccggatcgcccttccagttcaccgtgggaccgctgcgcgactctggcagc
catctggtcaaggccggaggttctggtctggagcgtggcattgtcggcgaggcggcggaa
ttcaatgtgtggacccgcgaggctggcggtggctccctggccatctccgtcgagggtccc
agcaaggccgatatcgagttcaaggaccgcaaggacggcagctgcgatgtctcgtacaag
gttaccgagccaggcgagtaccgtgtgggtctgaagttcaacgaccgccacatccccgac
tcgccattcaaggtctacgtctcgccggatgctggtgatgcccacaagctggaggtgcag
cagttcccccagggcaacatccaggcggatgccccctaccagttcatggtgcgcaagaac
ggcgccaagggcgagctggatgccaagatcgtggctccctccggcacggatgacgattgc
ttcatccaggtgatcgacggcgagatgtactcggtgcgcttctatcctcgcgaaaacggt
atccatgccatccacgtcaagttcaacggcgtccacattccggactcgccgttcagaatc
aaggtgggcaaggatgtggctgatccggccgctgtccacgccaccggcaacggactcgac
gaggtgaagaccggacacaaggccgacttcatcatcaacacctgcaacgctggcgtggga
actctggccgtttccattgatggaccctcaaaggtggccatggactgcacggaagtggag
gagggctacaaggtgcgctacaccccactgctcccgggcgagcactacatcacggtcaag
tacaacaacatgcatatcgtgggctcacccttcaaggtgaacgccaccggcgacaagctg
gcggacgagggcgcccaggagacgtcgactgtaattgtggagacggtccagaaggtggcc
aagggcggcaagaacactggcgtccatctgcccaccttcaagtcggatgccagcaaggtg
gtgtccaagggaatgggcctgaagaaggcttacattggcaagcagaaccagttcagcatc
tcggccactgatgcgggcaacaacatcttgtacgtgggcatgtacggaccgaggggtccc
tgcgaggagttccacgtcaagcacgccggccacaacaactacaatgtgcagtacctggtg
cgcgatcgtggccagtacgtgctgctgatcaagtggggcgaggagcacatacccggctcc
ccattccagattgatgtgtag

DBGET integrated database retrieval system