KEGG   Drosophila ananassae: Dana_GF17864Help
Entry
Dana_GF17864      CDS       T01059                                 

Definition
(RefSeq) GF17864 gene product from transcript GF17864-RB
  KO
K04437  
filamin
Organism
dan  Drosophila ananassae
Brite
Cytoskeleton proteins [BR:dan04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     Dana_GF17864
  Intermediate filaments
   Intermediate filament-binding proteins
    Dana_GF17864
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dana_GF17864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 2552 aa AA seqDB search
MPNSRGQHAGVGVLFNGDSPKTKDAKAQQIGNRGAAATGIGEIVQNASYANGQTTQATIF
LNHNNRKNPPTPNHNQNSAGPCVYNNNSNSEFAPIPNFSNLNFYAQPPAAHYDVCYQQVC
VCVVLCSNPNEYYQQAQQQGQPADQYEENFDEDMEAERDLAEDAQWKKIQQNTFTRWANE
HLKTIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKRPTFRSQKLENVSVALKFLQD
EGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDEKQLNGSGHTPKQRLLN
WIHAKIPDLPINNFTNDWTTGKAVGALVDACAPGLCPDWEMWDAKDAVQNASEAMGLADD
WLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYGPGIEPI
GPVVGAPANFTVETFSAGKGAVDVEIQGPNGEIEKADVRFNNDKNLTYTVSYIPKAEGPH
KVGVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILTKDAGRG
VPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKV
APLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGLPEVRVIGPGGMNQNVMLSKV
DGNTYECHYYPTKEGRYVIMVTFAGQEVPKSPFEIKVGPKKESSIVAYGPGLSSGVIGYP
AAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYLPTAVGEYAVHILCDNEDIP
KSPFIAQILPRTDFHPELVKSSGPGLEKNGVTINQPTSFTVDTSKAGNAPLDVVVQDVYG
TKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAARVQAFG
PWLQPGVHPNVPTHFNVDAREAGDAELKVKIVHEETKLEVPCRIIDNEDNTYSVEVIPPT
KGAYTTTMTYGGQRVPLGQKVVVEQTVDVSKIKVDGLEPTAPLNSLQQFRIITHGLPKAD
LAVTITSPSGNRVKAHIIPTAEGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGS
DSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVA
YLPTEAGDYTVNITFNERHINGSPFQPLIVPVPNLKNTRVSGIGIQPHGVIMNAATDFMV
DMSNVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNI
PVPGSPFVVNVKSGCDPSRCKAYGPGLETGLTNQKNKFTVETKGAGNGGLSLAIEGPSEA
KMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPTKVKVYGPGI
EHGQVRESVPTYFNVDVAEAGPGRIAVKLTNSEGIPVDNLRVEDKGNSIYAVHYVPPKAG
SVLTCQVKFSEVEVPCSPFVMTVFPKSEATKVKVKGVNEKKKTPASLPAEFEIDTKQAGQ
ADINVAIKNPKGKPMQPRLEEVASGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAF
PTGEAKKCKLVEQAPKIQPSGSQSHLKVDAREAGDGAVTCKITNKEGNEIVDIDVIEKDG
FFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQ
SELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPR
EEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASA
GGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGE
GRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPR
EIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGNGLKEGQTHADNIFSVDTRN
AGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKV
SGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQE
VEDGLYSVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGI
VGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFN
DRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGELDAKIVAPS
GTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHA
TGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGE
HYITVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFK
SDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPRGPCEEFHVKHAGHNNY
NVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV
NT seq 7659 nt NT seq  +upstreamnt  +downstreamnt
atgcctaactctaggggacagcatgccggcgttggggttttatttaacggtgattcgccg
aagactaaagacgccaaagcgcagcagatcgggaatcggggtgccgctgctaccggaatc
ggtgaaatagtgcaaaacgcaagctacgcgaacggtcaaacgacacaggcgacgatattc
ctcaaccataacaatagaaagaacccgccaactccgaaccacaatcaaaacagcgccggc
ccgtgtgtttataacaacaatagcaatagcgaatttgcgccaattccaaactttagcaat
ttgaatttctacgcccagccgccagcggcacactacgacgtttgctatcagcaggtgtgt
gtgtgtgttgtgttgtgttctaatccgaacgagtactaccaacaggcacagcagcagggc
cagccggcggaccagtacgaggagaacttcgacgaggacatggaggccgaacgggatctc
gccgaggatgcgcaatggaagaagatccaacagaacaccttcacccggtgggccaacgag
cacctgaagacgatagatcggtcgatcaacaacctggagacggatctctccgacggcctc
cgactgatcgccctgatcgaggtcctctcccagaagcgtatgcccaagtacaataaacgc
ccaacattccgcagccagaaacttgaaaacgtctcggtggccctgaaattccttcaggat
gagggaatcaaaatcgtaaacattgactcctcggacattgtggactgtaagctgaaactg
atactgggcctgatttggacactgatcctccactactcgatatcgatgcccatgtgggat
ggcgaggacgagaagcagctgaacggatcgggccacacgcccaagcagcgcctgctcaac
tggatacacgccaagatacccgacttgcccatcaataacttcaccaacgactggaccacg
ggcaaggctgtgggcgccctcgtcgatgcctgtgccccgggcctgtgtcccgactgggag
atgtgggatgccaaggatgccgtccagaacgcttccgaggccatgggcctggccgatgac
tggctcaatgtgcgccagctgatcaagcccgaggagctggtgaaccccaatgtggatgag
cagtcgatgatgacctatctgtcgcagtatcccaactctaagctcaagaccggagctccg
ctgaggcccaagaccaatcccaacagagtgcgtgcctatggtccaggaattgaacccatt
ggcccagtggtcggtgccccagccaatttcacggtggaaaccttctccgccggcaaaggt
gctgtggatgtggagatccagggacccaatggcgagatcgaaaaggctgatgtccgcttc
aacaacgacaagaacctcacctacaccgtctcgtacatacccaaggccgagggtcctcac
aaggtgggcgtaaagttctccggacgcgacatccccaagtcgccgttccccgtcaaggtc
gaaggacatgccggcgatgcctccaaggttaaggttactggtcccggcatccagcccaac
ggagtgaccattaagaagcctactttcttcgacatactcaccaaggatgcgggtcgtggt
gtgcccgaggtgatcatcatcgatccggccaaccacaagacctcggtggccgccaaggtg
cgtcagctggagaatgatacgtggcgttgcgagtacgtcactgctctgcagggtctgcat
tcggtaaacgtcttctacgccggcacacccattccgaacagtccattcccggttaaggtg
gccccactgtcggatgcccgcaaggtgcgcgcttccggccgtggcctccaggccaccgga
gttcgtgtcggcgacgatgcggacttcaagatctataccgagggtgctggcgagggtttg
cccgaggtgcgcgtcattggtcccggtggcatgaaccagaacgtgatgctgtcgaaggtg
gatggcaacacctacgaatgccactactatcccaccaaggagggtcgctacgtaatcatg
gtcacgtttgccggccaggaagttcccaaatccccgttcgaaataaaggtgggccccaag
aaggagtcctcgattgtagcctatggccctggcctgagcagcggtgtcattggctacccg
gctgccttcgtggtggagaccaatggcgagacaggcgccctcgggttcaccgtggccgga
ccctcgcaggccgagatcgagtgccacgacaacggcgatggatccgccctggtcaagtac
cttccgaccgctgtcggagagtatgccgtccacatcctgtgcgacaacgaggacatcccc
aaatccccgtttattgcccaaattctgccacgcaccgacttccaccccgagctggtcaag
agcagtggcccggggctggagaagaatggcgttactatcaatcagcccaccagtttcacc
gtagacaccagcaaggctggcaacgctcccttggatgtggtcgtccaggatgtgtacggc
actaagctgcctgtggagctgaagaacaacccggacggcaccaagaaggttacttacacg
cccacttccggagtcccccacaccgtcgaagttaactacggcggcgtctccactcccaat
tccccgcatcgcgtctacgtcggcgtccctgtggatgcggccagggttcaggccttcggt
ccctggctacagcctggagtgcatcccaatgtacccacccatttcaatgtggacgcccgc
gaggccggcgatgccgagctcaaggtgaagatcgttcatgaggagaccaagctcgaagtg
ccctgccgcatcatcgacaacgaggacaacacctactccgtggaggttatcccgccaact
aagggcgcctacaccacaaccatgacctacggcggccagagggttcctctgggacagaag
gtcgtcgtggagcagacagtggatgtgtccaagatcaaggtggacggactcgagccgacc
gcgcccctaaatagtttacagcagttccggatcatcacacacggcctgcccaaggcggat
ctggccgtgacgataaccagcccgtcgggcaatcgcgtcaaggcccacatcatacccacg
gctgagggcttcctggtcaacttcacgcccacccagctgggcgagtatctgctgagcatt
tgctttggtggcacaccgatcaccccacgacccttccggctgcagtgcctcacaggcagc
gactccaacaaggtacaggcctttggacctggattggagcggggaattgtgggccagccg
gcggagtttatgatcgacacacggggtgccgggcaggggggactgggtgttaccgtggag
ggtccctgcgaggcagccattaactgccgggacaacggcgatggcacctgcaatgtggcc
tacctgccgaccgaggcgggtgactacaccgtcaatataaccttcaacgagcgccacatc
aacgggtcgccattccagccgctgattgtcccggtgccgaacctgaagaacacccgggtc
agcggcatcggcatccagccgcatggtgtgatcatgaacgccgccacggacttcatggtg
gacatgagcaatgtgggaagcaacattgactccggcaaactgtcctgcgccatcttcgat
cccatgggccatgtcctgcccagcaagatcgtccagggacccaccgacgacatcttccgg
atcatgtacacgcccttcgaggccggtcgccacaccatcgaactgatgtacgacaatatc
ccggtgccgggatctccgtttgtggtaaacgtgaagagcggctgcgatccgtcgcgttgc
aaggcctacggacctggtctggagacgggcctgaccaaccagaagaacaagttcactgtg
gagacgaagggcgccggaaacggcgggctctctctggccattgaagggccctcggaggcc
aagatgacctgcacggataatcgcgacggcagctgcgatgtggactacttggccacggat
ccgggcgagtacgatatcaccattcgctttgccgacaagcacatccccggctccccgttc
cgcgtgctcgtggaggagacggtggatcccactaaggtgaaggtctatggacctggcatt
gagcacggccaggtgcgcgagagcgtgccgacctacttcaatgtggatgtggccgaggct
ggtcccggccgcatcgccgtgaagctgaccaactccgagggcattcccgtggacaacttg
cgggtggaggacaagggcaacagcatttatgccgtgcattatgtgccgcccaaggcggga
tccgttctcacatgtcaagttaagttctccgaagtcgaagtgccatgcagtccttttgtg
atgaccgttttccccaaatcggaagccaccaaggtcaaggtcaagggcgtcaatgagaag
aagaaaactcccgcctccctgcccgccgaattcgagatcgacacaaaacaagccggccag
gccgacatcaatgtggccatcaagaatccgaagggcaagccgatgcagccccgcctcgag
gaagtggccagtggcacgtacgtggtgtcctttgtgccggacgagtgcggaacgtaccaa
tgcagcatcaagtacggcgacaaggagatcgaggggtcgcccttcaaactcgaagcattc
cccaccggcgaggccaagaagtgcaagctggtggagcaggcgcccaagatccagccctcg
ggcagtcagtcgcacctgaaggtggacgcccgtgaggccggagatggtgctgtgacctgc
aagataaccaacaaggagggcaacgagattgtggacattgatgtgatcgagaaggacggc
ttcttcgatatcctgtacgccctgaacgatcctggcgactacgacatcaatgtgaagttt
ggcggcaaggacataccgaacggcagcttctccatcaaggctgtcgaaagtatcgaacaa
tattcgcatagtgagtacatcgaggagcacacgaccaaggtggtgcagcaaacaacgcag
agcgagcttgtgaacggaaaatctgagatcacataccgaagtgttgccttcgaaaaattg
ccacttcccacgacaggcggtaacgtaacagctgaagtcagaatgccaagcggtaaggta
gacaaacccgttattcaggacaaccgtgacggtaccgtctcggtcaagtacgatccccgt
gaggagggatcccacgagctggtggtcaaatacaatggagagcccgtccaaggttctccc
ttcaaattccacgttgactcgatcacctccggctatgtgactgcttacggacctggtttg
acccatggtgtgaccggcgagccggccaacttcaccatctccaccaagggagccagcgcc
ggtggcctgaccatggccgtcgaaggacccagcaaggcggacatcaactaccatgataac
aaagatggcaccgtgtccgtgcaatacctgcccactgcccccggcgagtaccaggtgtcg
gttcgcttcggcgacaagcacatcaagggatcgccctactttgccaagatcaccggtgag
ggacgcaagcgcaaccagatctcggtcggttcctgctccgaggtgaccatgcccggcgac
atcaccgacgatgatctgcgcgccctgaacgcttccatccaggctcctagtggcctggag
gagccgtgcttcctgaagcgcatgcccaccggaaacattggcatctcgttcacgccccgc
gagatcggcgagcacttggtgtcggttaagcgcctgggaaagcacatcaacaactctccc
ttcaaggtcaccgtttgcgagcgtgaggtgggcgatgccaagaaggtcaaggtcagcggt
aacggcctgaaggagggtcagacccatgccgacaacatcttctccgtggacacacgcaac
gccggattcggtggtctttccgtctcgatcgagggtcccagcaaggctgagatccagtgc
acggacaaggacgacggcactctcaacatctcctacaagcccacggagccaggttactac
attgtcaacctgaagttcgctgatcaccacgtggagggatccccattcaccgtcaaggta
tctggagagggcagcaaccgcaagcgcgagaagatccagcgtgagcgggatgccgtcccc
atcacggaaatcggcagccagtgcaaactgaccttcaagatgcccggcatcacctccttc
gacttggccgcctgtgtcacctcacccagcaacgtgactgaggatgccgagatccaggag
gtagaggatggcctctactcggtgcactttgtgcccaaggaactgggcgtgcacaccgtc
tcggtgcgctactctgagatgcacatacccggatcgcccttccagttcaccgtgggaccg
ctgcgcgactctggcagccatctggtcaaggccggaggttctggtctggagcgtggcatt
gtcggcgaggcggcggaattcaatgtgtggacccgcgaggctggcggtggctccctggcc
atctccgtcgagggtcccagcaaggccgatatcgagttcaaggaccgcaaggacggcagc
tgcgatgtctcgtacaaggttaccgagccaggcgagtaccgtgtgggtctgaagttcaac
gaccgccacatccccgactcgccattcaaggtctacgtctcgccggatgctggtgatgcc
cacaagctggaggtgcagcagttcccccagggcaacatccaggcggatgccccctaccag
ttcatggtgcgcaagaacggcgccaagggcgagctggatgccaagatcgtggctccctcc
ggcacggatgacgattgcttcatccaggtgatcgacggcgagatgtactcggtgcgcttc
tatcctcgcgaaaacggtatccatgccatccacgtcaagttcaacggcgtccacattccg
gactcgccgttcagaatcaaggtgggcaaggatgtggctgatccggccgctgtccacgcc
accggcaacggactcgacgaggtgaagaccggacacaaggccgacttcatcatcaacacc
tgcaacgctggcgtgggaactctggccgtttccattgatggaccctcaaaggtggccatg
gactgcacggaagtggaggagggctacaaggtgcgctacaccccactgctcccgggcgag
cactacatcacggtcaagtacaacaacatgcatatcgtgggctcacccttcaaggtgaac
gccaccggcgacaagctggcggacgagggcgcccaggagacgtcgactgtaattgtggag
acggtccagaaggtggccaagggcggcaagaacactggcgtccatctgcccaccttcaag
tcggatgccagcaaggtggtgtccaagggaatgggcctgaagaaggcttacattggcaag
cagaaccagttcagcatctcggccactgatgcgggcaacaacatcttgtacgtgggcatg
tacggaccgaggggtccctgcgaggagttccacgtcaagcacgccggccacaacaactac
aatgtgcagtacctggtgcgcgatcgtggccagtacgtgctgctgatcaagtggggcgag
gagcacatacccggctccccattccagattgatgtgtag

DBGET integrated database retrieval system