KEGG   Drosophila ananassae: Dana_GF17959Help
Entry
Dana_GF17959      CDS       T01059                                 

Gene name
Dana_Desat2
Definition
(RefSeq) Desaturase 2 (EC:1.14.19.-)
  KO
K00507  
stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
dan  Drosophila ananassae
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dana_GF17959 (Dana_Desat2)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dana_GF17959 (Dana_Desat2)
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dana_GF17959 (Dana_Desat2)
Lipid biosynthesis proteins [BR:dan01004]
 Desaturase
  First
   Dana_GF17959 (Dana_Desat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 374 aa AA seqDB search
MPPNSKESTDKCTGLASEVPGTVDDGSSKQTGVLFEADVETNDGDLAVSTVEFKRAEKRK
LELVWRNIILFAYVHLAALYGGYLMFTQAKLATTIFAAGLYICGMLGITGGAHRLWAHRS
YKAKWPLRLILIVFNTIAFQDAAYHWARDHRVHHKFSETDADPHNATRGFFFSHVGWLLT
KKHPDVKAKGKILDLSDLHADPILMFQKKHYFVLMPLACFILPTIIPVLCWNESLTCGWL
VATMFRWCFQLNMTWLVNSAAHKFGGRPYDKNMNPSENAYVATMTFGEGWHNYHHVFPWD
YKTSEWGNRLNMTARFIDLFAKIGWAYDLKSVAPDTVKRRVWRTGDGSHELWGWGDKDLT
PEDAKDVLFVDKMN
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgccacccaactcgaaagaaagcacggacaagtgcactggactagcgtccgaagtgccc
ggaactgtggatgatggatcatccaagcaaacgggagttctcttcgaggccgatgtggag
acaaatgatggtgacttggccgtgtccaccgtcgaattcaagcgagccgagaagaggaaa
ctggaactggtctggcgaaacatcattttattcgcgtatgtccatctggctgctctatat
ggcggatacttgatgttcacccaggcaaagttggccactacaattttcgcggctggcctc
tacatatgcggaatgcttgggattactggcggtgcccaccgactctgggcgcaccgatcc
tacaaggccaagtggcctttgcgcctcatcctgatcgttttcaatacgatagccttccag
gatgccgcctaccactgggcccgagatcatcgggttcatcacaaattttcggagacggac
gcggatccgcacaacgccaccagaggcttctttttttcgcatgtgggttggcttctcacc
aaaaaacatccggacgtaaaggccaagggaaagattcttgatctgtccgatctgcatgcc
gatcccatcctaatgttccaaaaaaaacactattttgttttaatgccgctggcctgcttt
atccttccaaccattatcccggtgctctgctggaatgagtccttgacttgtgggtggcta
gtggccaccatgttccgatggtgcttccaactgaacatgacgtggttggtgaacagcgca
gctcacaaattcggcggtcgtccttatgacaagaacatgaatccctcggaaaacgcctat
gttgcgacaatgaccttcggggagggctggcacaactaccatcatgtctttccctgggac
tacaagacatccgagtggggcaaccgcctgaacatgacggccagattcatagatcttttc
gccaagatcggctgggcttatgatctcaagtcggtggctccggacacagtcaagaggcgg
gtatggcggactggcgatggcagccacgagctgtggggctggggtgacaaggatctcacg
ccggaagatgccaaggatgtgctttttgtggacaagatgaactag

DBGET integrated database retrieval system