KEGG   Drosophila ananassae: Dana_GF18009Help
Entry
Dana_GF18009      CDS       T01059                                 

Definition
(RefSeq) GF18009 gene product from transcript GF18009-RB
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dana_GF18009
Chromosome [BR:dan03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     Dana_GF18009
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 343 aa AA seqDB search
MKRLTERVHHEEIESEEVVWVKREDARSSSKLPIVYSKKYAVRFAGLERLHPFDAAKGKH
IQKILCTELNLNDGSFYEPKELTKDQLRRIHTRDYLRSLDWSMNVACIAEVPVMAFVPNR
FIQSSYLRPMRFQAAGSILAGKLALDYGWAINLGGGFHHCCSYRGGGFCPYADISLLIIR
LFEQEPFRVRRIMIVDLDAHQGNGHERDFTNVAAVYILDMYNAFVYPKDHAAKQSIRCAV
ELRHHTEDAFYLRQLSRCLMQSLAEFRPDVVIYNAGTDVLKGDPLGNLSITPEGVVERDR
LVFSTFRTLRIPVVMLLSGGYLKESAGVIADSIANLRQQGLLD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgactgactgagcgagtccaccacgaggagatcgagtccgaggaagtggtctgg
gtaaaacgggaggatgccaggtcctccagcaaactgcccattgtctattccaaaaagtat
gcggtgcgtttcgctggccttgaacgtctgcacccattcgatgcggccaagggcaagcac
attcagaagatcctatgcaccgaacttaacctgaatgacggcagcttctacgagcccaag
gagttgaccaaagaccaactgcgtcgcatccacacccgggactatttgaggtccctcgat
tggagcatgaatgtggcctgcattgccgaagtgccggtgatggcctttgtcccaaatcga
ttcatccaaagctcttacctacgacccatgcgtttccaggccgccggctctattttggcc
ggtaaactagccttggattatggctgggccattaacttgggtggaggtttccaccactgc
tgctcgtacagaggcggcggcttctgtccgtatgcggacatttcgctcctcatcatccgg
ttgtttgagcaggagccattccgtgtgcgccgcatcatgatcgtcgatctggacgcccac
cagggcaacggacacgaacgcgacttcaccaacgtggccgctgtctatatattggacatg
tacaatgcctttgtgtatccaaaggatcacgcggccaagcagagtatacggtgtgccgtt
gagttgcgacaccacaccgaagatgcattctatctgcgtcagcttagccgttgcctgatg
cagtccctcgcggagtttcgtccggatgtggtcatttataatgcagggacggatgtttta
aagggggatcctctcggcaacttatccataaccccagaaggcgttgtagagcgggatcgt
ttggtgttcagcacattccgcactctacgaattcctgtggttatgctgctaagcggaggt
tatttgaaggagtccgccggagtcattgccgactccattgccaatctccggcaacagggt
ttgcttgattaa

DBGET integrated database retrieval system