KEGG   Drosophila ananassae: Dana_GF18009Help
Entry
Dana_GF18009      CDS       T01059                                 

Definition
GF18009 gene product from transcript GF18009-RA
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 341 aa AA seqDB search
MKRLTERVHHEEIESEEVVWVKREDARSSSKLPIVYSKKYAVRFAGLERLHPFDAAKGKH
IQKILCTELNLNDGSFYESLTKDQLRRIHTRDYLRSLDWSMNVACIAEVPVMAFVPNRFI
QSSYLRPMRFQAAGSILAGKLALDYGWAINLGGGFHHCCSYRGGGFCPYADISLLIIRLF
EQEPFRVRRIMIVDLDAHQGNGHERDFTNVAAVYILDMYNAFVYPKDHAAKQSIRCAVEL
RHHTEDAFYLRQLSRCLMQSLAEFRPDVVIYNAGTDVLKGDPLGNLSITPEGVVERDRLV
FSTFRTLRIPVVMLLSGGYLKESAGVIADSIANLRQQGLLD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgactgactgagcgagtccaccacgaggagatcgagtccgaggaagtggtctgg
gtaaaacgggaggatgccaggtcctccagcaaactgcccattgtctattccaaaaagtat
gcggtgcgtttcgctggccttgaacgtctgcacccattcgatgcggccaagggcaagcac
attcagaagatcctatgcaccgaacttaacctgaatgacggcagcttctacgagagcttg
accaaagaccaactgcgtcgcatccacacccgggactatttgaggtccctcgattggagc
atgaatgtggcctgcattgccgaagtgccggtgatggcctttgtcccaaatcgattcatc
caaagctcttacctacgacccatgcgtttccaggccgccggctctattttggccggtaaa
ctagccttggattatggctgggccattaacttgggtggaggtttccaccactgctgctcg
tacagaggcggcggcttctgtccgtatgcggacatttcgctcctcatcatccggttgttt
gagcaggagccattccgtgtgcgccgcatcatgatcgtcgatctggacgcccaccagggc
aacggacacgaacgcgacttcaccaacgtggccgctgtctatatattggacatgtacaat
gcctttgtgtatccaaaggatcacgcggccaagcagagtatacggtgtgccgttgagttg
cgacaccacaccgaagatgcattctatctgcgtcagcttagccgttgcctgatgcagtcc
ctcgcggagtttcgtccggatgtggtcatttataatgcagggacggatgttttaaagggg
gatcctctcggcaacttatccataaccccagaaggcgttgtagagcgggatcgtttggtg
ttcagcacattccgcactctacgaattcctgtggttatgctgctaagcggaggttatttg
aaggagtccgccggagtcattgccgactccattgccaatctccggcaacagggtttgctt
gattaa

DBGET integrated database retrieval system