KEGG   Drosophila ananassae: Dana_GF18138Help
Entry
Dana_GF18138      CDS       T01059                                 

Definition
GF18138 gene product from transcript GF18138-RA
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
dan  Drosophila ananassae
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Dana_GF18138
Enzymes [BR:dan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Dana_GF18138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 283 aa AA seqDB search
MLKRKLEKQRANLECEENKRLALPGDGPTSELFPQPLWQQFFNIEAKLNDNLDQMIHPLP
PNVTCIYNPIVYASQLHCDYLRRYLEGPKKLIFVGMNPGPNGMCQTGIPFGNVRTVKVLM
QLNEMVNKPPIEHPKRPVMGLDCLTEEPSGVRLWELFLQLAGNMETFSQQCFVHNFCPLA
FFDEAGKNLTPSELKGPYKKELGKHCLEALEEELVLLKPMVVVAVGNYVRDILKGSNYCK
SASVSVLLLPHPSPRSVNNANWPEKAKAFLEEHNLLPFMKNEA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaacgcaagttggaaaaacagagagcgaacctggaatgcgaagaaaacaagaga
ttggccttgccaggggatgggccaacatcggaactgtttcctcaacccctgtggcagcag
ttcttcaacatcgaggcaaagctcaatgataatttggatcaaatgattcaccctcttccg
ccaaatgttacgtgcatttacaatccaatagtctatgcgtcacagctgcattgcgactat
ttgcgtcgttatttagaaggacccaagaagctaatctttgtgggaatgaatcctgggccg
aatggaatgtgccaaactggcataccctttggaaatgtccgcactgtgaaagtgttaatg
cagcttaatgaaatggtgaataagcctccaatagagcatccgaaacgtcctgtcatgggc
ttggactgtctgacggaagagccaagcggtgttcgcctctgggagctatttttacaattg
gccggaaatatggaaacgttttcacagcaatgcttcgttcataatttctgtcctctagca
ttcttcgacgaagctggaaaaaatctgacacccagtgagcttaaagggccctataaaaag
gaactagggaaacactgcttagaggcccttgaggaggaactggttttgctgaagcccatg
gtagttgtggcagtgggaaactatgtgcgggacattttaaaaggttctaattactgcaaa
tcggcttctgtttccgttctcctgctgcctcatccaagtcctcgatccgtgaataacgcc
aactggccagagaaggcgaaggctttcctggaggagcacaatctgcttccattcatgaaa
aatgaggcataa

DBGET integrated database retrieval system