KEGG   Drosophila ananassae: Dana_GF18260Help
Entry
Dana_GF18260      CDS       T01059                                 

Definition
(RefSeq) GF18260 gene product from transcript GF18260-RA (EC:2.4.1.-)
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dan  Drosophila ananassae
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dana_GF18260
   00053 Ascorbate and aldarate metabolism
    Dana_GF18260
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dana_GF18260
   00860 Porphyrin and chlorophyll metabolism
    Dana_GF18260
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dana_GF18260
   00982 Drug metabolism - cytochrome P450
    Dana_GF18260
   00983 Drug metabolism - other enzymes
    Dana_GF18260
Enzymes [BR:dan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dana_GF18260
Glycosyltransferases [BR:dan01003]
 Others
  Hydrophobic molecule
   Dana_GF18260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 535 aa AA seqDB search
MRISSSGAGIGLFFVVGLVLVLSSNADDKVKSSRILAVFPFPGRSQYIFAEQYLKELSRR
SHNVTVINTFGSDKIEPNFRVIGAKKIHELMAAFNSIMYNAPASQWKMLTMTTEFINLLT
TCILDDPAVKELLASDERFDMVVFETVQNEALFGLAQHFGALTMGISSYGTDRHIDELMG
NISPLSYNPMLLSSRTERMNFEDRFWNLWDALLLWVHKRVVHLPTQRDLLKKYFPESKQS
LEEIMDKFSLVLMGQHFSLSYPRPYLPNMIEVGGLHLQQQRKVQPLPQELSDFVGQATEG
VIYFSMGSNIKSKDLPPSVRQALMETFASLPQSILWKFEDDQLEEKPANVFISKWFPQPD
ILAHPNVKLFITHGGLLSTIESIYFGKPVLGLPVFYDQHLNIQRAKQAGYGLSADLWSSN
ATVLIPLIQELLVNPSYAKAAETKSRLFRDQKETALERAIWWTEYVLRNDGAAHMRCASP
DLSFVQFHGLDTWGLLLALALLVLLSFAIVLKLLFRGLCYVIVKRRHRTNKLKTH
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatttcaagttctggtgctggtatcggccttttttttgttgttggcttggtgctt
gttttgagttctaatgccgatgacaaggttaaaagttcccgcattctggcggtgtttccc
ttccccggtcgatctcagtatattttcgctgaacagtaccttaaggagctatcccgacgt
agtcacaatgtcacagtaattaacaccttcggtagcgacaaaattgagcccaattttcgt
gtaattggtgcaaaaaaaattcacgaactaatggcagcttttaacagtattatgtacaat
gcgccagctagccagtggaaaatgctgaccatgaccacagagttcatcaatcttctaacc
acttgcattctggatgatccggctgtgaaggagttgctggccagcgacgagaggttcgac
atggtcgtattcgaaacggttcaaaacgaggctctttttggattagcccagcactttgga
gccctaaccatgggaatttcatcgtatggaacagatcgccatatcgacgaattaatgggc
aatatctcgccactgtcctacaatcctatgctcttgtcatcacgaacagaacgaatgaat
ttcgaagatcgcttctggaacctttgggatgccttgctcctttgggtgcataagcgagtt
gttcacttgccaactcagagagacctgcttaaaaaatactttccagagtccaagcaatct
ctagaggagatcatggataaattctcactggttctgatgggtcagcacttttcactgagc
tacccgcgcccctatctgcccaatatgatcgaagtgggaggactccatctgcagcagcaa
cgtaaagtgcaacctctgccccaggaactttcggattttgtcggtcaagccactgaggga
gtaatatatttctcgatgggctccaacatcaaaagcaaggacctgccaccgtctgtccgt
caagctctgatggaaacctttgccagtttgcctcaaagtatactgtggaaattcgaggac
gatcagctggaagagaaaccagctaatgttttcattagcaagtggtttcctcaaccagat
attctggcccatccgaatgtaaagctgttcattacccacggcggattattgagcaccatc
gagagcatatattttggaaaaccagttttgggactgccagttttctacgatcagcactta
aatatccagagggccaagcaggcgggctatggtctaagtgccgatttgtggagttccaat
gccactgtgttgattccgttgatccaggaactgctggtgaatcccagctatgctaaggcc
gctgagaccaagtctaggctattccgcgatcaaaaagagaccgccttggaacgtgccatc
tggtggacagagtatgttctgcgaaatgatggcgccgcccacatgaggtgtgcctccccc
gatctcagctttgtgcagttccacggattggatacctggggccttctcctcgcactcgcg
ttgctcgtgctactgagctttgcaattgttctgaagcttctgttcaggggcctttgttat
gtaatcgttaagcgtcgacatcggacgaataaattgaagacccattaa

DBGET integrated database retrieval system