KEGG   Drosophila ananassae: Dana_GF18327Help
Entry
Dana_GF18327      CDS       T01059                                 

Definition
GF18327 gene product from transcript GF18327-RA
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
dan  Drosophila ananassae
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dana_GF18327
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    Dana_GF18327
   04068 FoxO signaling pathway
    Dana_GF18327
   04070 Phosphatidylinositol signaling system
    Dana_GF18327
   04150 mTOR signaling pathway
    Dana_GF18327
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     Dana_GF18327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1099 aa AA seqDB search
MNQAFIMERPCMDSMVALDHMQLVNYQDQIDGMEQELNSRFSVDLWRNEWPEIVNLICML
PNGFLTVLTTQSTTTISDIKEKLVQIAKQMPLGFLIKKACDYQVYGLSTFNIEPYIDETK
RICEVQPYFGLLRLSDRTDDTSFSSDYELAKLVSGMIGKSFDHHRTLGTPEIDDFRLNMT
QICDSIEMERSVYTWQQWLLYEYPLRLANSTKMPLLIRERHPTRTFLIVVKNENDPSTFT
LSVSEQDTPLSLTESSLQKMNRSQMKMYDRASDYILKVSGRDEYLFGDYPLIQFLYIQEM
LSDTAVPNVVLQSIYRLEPYINHNNDQNMVPRRLPPKKRPAILPKTPTSLWDMGNYFQFT
LHSIGNVNYDKSRALKVGVHVGLFHGEQKLCAQRSADAPNSGSDTFLFNDLVMSFDIQMR
NLPRMTRLCIVIFEVTKMSRSKKSSNNKDNSLKDVSYNKNPLAWVNTTLFDYKDNLRTGS
QTLYTWTYADDIQSDEVFHPLGTIESNPRKEECALLHLTFHGNGTGCVRYPTEDAVLQYA
ADRAAASLRESQLQQPQQLAEKPLKVLKDLLANYSGLDKIYEMVDQDRNAIWERRNDIMR
ELPEELSILLHCVYWKERDDVADIWYLLKQWPLISIERSLELLDYAYPDPAVRRFAIRCL
QYLKDEDLLLYLLQLVQAIKHESYLESDLVVFLLERALRNQRIGHYFFWHLRSEMQSPSM
QTRFGLLLEVYLKGCKHHVAPLRRQLQVLEKLKHSSVIAKKGSKEKVKSLLQDFLRDQRN
TGIFQNILNPLNPSFRCSGVSPDKCKVMDSKMRPLWVVFENADKTSNEVSIIFKNGDDLR
QDMLTLQMLRVMDQLWKRDGMDFRMNIYNCISMEQRLGMIEVVRDAETIANIQKEKGMFS
ATAAFKKGSLFSWLKEHNPNSLSKAINEFTLSCAGYCVATYVLGVADRHSDNIMVKKNGQ
LFHIDFGHILGHFKEKFGVKRERVPFVLTHDFVYVINNGCNDREAKEFCHFQDLCERAFL
ALRKHGCLILSLFSMMISTGLPELSSEKDLNYLRETLVLDYTEEKAREHFRGKFKEALAN
SWKTSLNWASHNFSKNNKQ
NT seq 3300 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggcattcattatggagcgcccttgcatggacagcatggtggcgttggaccat
atgcagttggtgaactaccaagatcaaatagatgggatggagcaggagcttaacagcagg
ttctccgtcgacctgtggcggaacgagtggcccgaaatcgttaatttaatatgcatgctg
cccaatggtttcctcacagtactcaccacccaatccacgaccaccatcagcgacatcaag
gagaagctggtccaaatagcaaagcagatgccattgggattcttgatcaagaaggcctgc
gactaccaagtgtatggcctctcaaccttcaacatcgagccctacatagatgagacgaaa
cgtatatgcgaagtccagccctattttggactgttgcgcctaagcgatcggactgatgac
accagcttctccagcgactatgagctggccaagttagtgagcgggatgatcgggaaatcc
ttcgaccaccatcgaacgctgggcacgcctgaaatcgacgacttccgactaaacatgacg
cagatctgcgacagcattgagatggagcgctccgtctacacttggcagcagtggctgctc
tacgagtaccccctgcgactggccaactccacaaagatgcccctactcatacgcgagagg
catccaacgcgcacgttcctgattgtggtaaagaacgagaatgatcctagcacattcacc
ttgtccgtcagcgaacaggatacaccgctgtccctgacggaaagctcactgcagaagatg
aaccggtcgcagatgaagatgtacgaccgagcctctgactacatactcaaagttagcggc
cgggacgagtaccttttcggagactacccgcttatccagttcctgtacatccaggaaatg
ctctcagacacagcggtgccaaatgtggtattacagtcgatataccgactcgagccttac
ataaaccacaacaatgatcagaacatggtgccgaggcgattgccgccaaaaaagaggcca
gcaatattgccgaaaacaccgacatcgctgtgggacatgggcaactactttcagtttacg
ttgcacagtatcggtaatgtcaactacgacaaatctcgtgccctaaaggtgggtgtgcat
gtgggtctgtttcacggcgagcagaagctgtgcgcccagcgttcggctgacgcgcccaac
agtggctccgacacgttcctcttcaacgatctggtgatgagtttcgacattcagatgcgc
aacctgccacgaatgactcggctctgcatagttatcttcgaggtgacgaaaatgtcccgt
tcgaagaagtcatccaacaacaaggacaactccttgaaggacgtctcctacaacaagaac
ccactggcctgggtgaacacaacgcttttcgactataaggataacttgcggaccggcagc
cagacgctctacacttggacgtatgcggacgacatccagtctgacgaagttttccatccg
ctggggaccatcgaatcgaatccacgcaaggaggagtgtgccttgttgcatctcacattc
cacggcaacggaacgggatgcgtgcgttaccccaccgaggatgctgtgctgcaatacgct
gctgatcgggcggcagctagtctgcgggaatctcagctgcagcagccacagcaactggcg
gagaaacccctcaaggtgcttaaggatcttctggccaactactccggtctggataagata
tacgaaatggttgatcaggatcgcaatgccatttgggagcgaagaaatgacattatgcga
gagttacccgaagaactttccattctgctgcactgcgtctattggaaggagcgcgacgat
gtagcagatatctggtatcttctcaagcagtggcccctcatctccattgaacggtcgttg
gagctgcttgactatgcctatcccgatcccgcggtacgacgctttgctatccggtgcctg
caatatctcaaagacgaggacctgttgctttacctccttcaactggtgcaggccatcaag
catgaatcttatctggagagcgacctggtagtgttcctgctggagcgagcactccgcaat
cagcgcattggacactacttcttttggcatctgcgctccgagatgcaatccccttccatg
cagacccgtttcggtctcctattggaggtttacctgaagggctgcaagcatcatgtggcg
cctctgcggaggcagttgcaagtgctggaaaaactaaaacacagctctgtgattgccaag
aagggcagcaaggagaaggtcaagtcgctgctgcaggactttctgcgagatcaacgaaac
acgggaatcttccaaaacatattaaatcctctgaatcctagcttccgctgtagtggcgtt
tcgccagacaagtgcaaggtgatggacagtaagatgcgtcctctctgggtggtgttcgag
aatgcagacaaaacctccaacgaggtcagcatcatcttcaaaaacggcgatgatctgcgc
caggacatgctaacgctgcagatgttacgggtgatggatcagctatggaaacgagatggt
atggactttcggatgaacatctacaattgcatcagcatggagcaacggttgggcatgatc
gaggtggtccgggacgcagagactattgccaacatccaaaaggagaagggaatgttttcg
gccacggcagcattcaaaaagggctccctcttcagttggctgaaggagcacaatccgaac
agtctgagcaaggccatcaacgagtttacgctcagttgcgccggatactgtgtggctaca
tatgtccttggcgtggccgaccgacactcggacaacataatggttaaaaagaatggacag
ctctttcatatcgactttggccatatcctgggacactttaaggaaaagtttggcgtgaag
cgcgagcgggtgccgttcgtcttaactcatgacttcgtgtacgtcataaacaatggctgc
aacgatcgcgaggccaaggagttttgccactttcaggacttgtgcgagagagccttctta
gctttacgcaaacacggctgccttattttatcgctgttctcaatgatgatatcaacggga
ctgccagaactgtcctctgagaaggacctgaactatctgcgtgaaactttagttcttgac
tacacggaggagaaagcacgtgaacatttccgaggaaagttcaaggaagctttggccaac
tcctggaagacctctctcaattgggcctcgcacaacttctccaagaacaacaaacagtaa

DBGET integrated database retrieval system