KEGG   Drosophila ananassae: Dana_GF18386Help
Entry
Dana_GF18386      CDS       T01059                                 

Definition
GF18386 gene product from transcript GF18386-RA
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
dan  Drosophila ananassae
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dana_GF18386
Messenger RNA biogenesis [BR:dan03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dana_GF18386
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1314 aa AA seqDB search
MERRFSLSNFSPSPRLSNPMADSTRLDASSISSGVPAASGLPLGLSPRRQSNLLNGTRTP
DRSFANQTSASISRQKLNLSQLDPKTFADVHSSGLASRIVSYHDNSLGGRGGLQRSMSAS
NLYNPMLKPRRMPGAPLPYKATVPALSMTKIAPPERSFYSGNTLPSLLRSNSLVGVVHKA
SEQEQLSRENRPILHPPHPQHDSEPTRSVLDELKEISRKRINSGEPQSPHDFTKRSCQRV
DFVDHHNFHHHQQQHQQTLKRQRELTVTVPLRHHSVALAAPPPTLPHIHSNGSNVSPQQS
PEQLAKRRNCSFNNGIASSLSSSRRHTNKRKLFDLRESSHNHTNDSVRSGYSPDNSLVEN
AAKVQRKVDGASVSKTRSMPVSSAIAVALPRTQSVPPVVQPAVEAQPRTTKPKLTLFNAT
QSDKEQKPQKLKDLESPDVDAGEYAGIQFVKPKQQSSALGVRNPNADRTTKTKLAIMLSG
LKGELYQGEPDELDATLPKPAALPTPIKPTVVAPTVPATTTEAKTTVSPIKPLILSNELI
KPANDTSAAPAVPSSSTTSTVTSTPKPEKTPAVAEIKPISSLTAPSSTAAPSTTVTPSLT
VAPSLTSAPSSTAAPTLTTTFASPKLTDGTPKPALFSFGATSSTASTTPVSTSTPAFTFG
QKPAGGPTVGAATAFKLETPMSKTLTTPTTSNTVTPSTTSLSFGGPPKPVTSSAPSLKFG
MPEQPAASSAAGATLPVFGAPAPASSEPSSAKAPSATVAPLPSATSGLAEAPKPFAFGQP
SSANSGGISGGPAAKPAVFNFGGSTAQVSAPAAPQPTDLFGGQNKPQSNTFGGVFAAPTA
AKPEPAKPGIFGSQDNSFGSAFKPSEPIKPFPFNETTPAAGGPKPSSNLFTFGGATTPAK
PDAPAPNPSTNVFGQPKSPAPTPFAFSMGSSGNAEKPVFAFGGVGGGGGGGDSSKPSSVF
NFGGGDKSNAAATPSAVSSAATSTSNGFGFSQVQKPATPMFGSTSTQDNTNSLGGSKPFT
FGGDAQQAAGPAAGGFSFASVAKKAEEPKQTNIFGSSASASNSTFAFGGNNSNNQAGGPP
AAASGGFSFAAVAAKKDKPAGTNLFGNPAAATAGMAKPAFNFGGGSASTPQAAPSFGGFG
AAASQAPSAAAAPPTAPGHNKPFAFGQSAAGPAPGGNLFASAVAAAQNQPAKPPSFSFGG
AANPPASNATGNAPFSFGGATAGGIASQPSNQSMNTPKQFSFGGASSNPVQSAFGSPAPS
PIPSAQNAAGGAYNFGGGPATPTQPGNAGGMGVGQPPGTPENRLIRKATRRLQK
NT seq 3945 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtcgatttagtttgagcaacttctcgccctcgccgcgtctctcgaatcccatg
gcggattccacgcggctcgacgcgtcttccatatctagtggggtccctgccgccagtggc
ctgcccctgggactgagtcctagacggcagagcaaccttctcaacggcacccgcacacca
gacagatcgttcgccaaccagaccagtgccagcatctcgcgacaaaaactgaaccttagt
cagttggatcccaaaacctttgccgatgtccatagcagtggcctggcttcccgaatagtt
tcttatcatgacaatagcctcggcggacgaggaggcctgcagcgcagcatgtccgccagc
aacctgtacaaccctatgcttaaaccacgaaggatgccaggagccccattgccgtacaag
gcgaccgttccggccctttcgatgactaaaattgccccgcccgagaggagcttctattcc
ggaaataccctgcctagtctattgcgctccaactcactggtaggtgtcgttcacaaggcc
agcgagcaggagcagctatcccgggagaaccgccccatcttgcatcccccgcacccgcaa
cacgacagcgaacccacccgaagcgtgctggacgagctgaaagaaatatcgcgaaaacga
atcaacagtggcgaaccgcagtcgccgcacgactttacgaagcggagttgccagcgggta
gattttgtggatcatcacaatttccatcatcaccagcagcagcatcagcagaccctcaaa
aggcaacgggagcttactgtgaccgtcccgctacgacaccactcggtggccttggccgct
ccgccgccgacattgccgcacatccactccaatgggtccaatgtctcgccccaacagtca
cccgagcagctggccaagagacggaattgcagtttcaacaatggcatcgcctcctcgttg
agctcaagccggcggcataccaacaaaagaaagctgttcgatcttcgggaaagcagccac
aaccataccaacgattctgtacgcagcgggtactctcccgacaactccctcgtcgagaat
gcggccaaggtgcagcgcaaggtggatggtgcatccgtgagcaaaacgcgaagtatgccg
gtttcgtctgcgattgctgtggcgcttccacgaacccagtctgttcctccagtcgtccaa
cctgccgtcgaggctcagccgaggaccacgaaaccgaagctcacgctgtttaatgccacg
cagagtgataaagaacaaaagccgcaaaagctgaaggacctcgaaagcccggacgtggat
gctggggagtatgcgggcattcagtttgtgaagccgaagcagcaaagttcagcgctgggt
gtcaggaatcccaatgccgatcgcacaacaaagaccaagctggcgataatgttgagtggc
ctgaagggtgaactctatcaaggggagccggacgaactggacgcaacattgccgaaacca
gcagcactgccaacgccgatcaaacccacagttgtggccccaactgtgccagcaacgacg
accgaagccaagacgactgtgtcgcccattaagccacttatattaagtaatgaactaatt
aagccagctaatgatacaagtgcagctcctgcagttccatcttcctctaccacgagcaca
gtgacatcgacacccaagcccgagaagactcctgcagtggcggaaatcaagccaatctcc
agcctgaccgcgccaagctcgactgcagctccaagtacgactgtgactccaagcttgact
gtagctccaagtttgacttcagctcccagctccaccgcagctcccactctcacgactact
tttgccagtccgaagctaacagatggaacccccaaacctgcacttttttcatttggtgct
acgagcagcactgctagcaccactcccgtttctacttcaactcccgccttcactttcggc
caaaagccagccggcggacctacagtaggcgctgccacagcatttaaactcgagactccg
atgagtaaaacactcacaacaccgacgacaagcaacacagttactccttctacaactagc
ctgtcctttggaggaccaccgaaaccagtaacatcctctgcaccatccctgaaattcggc
atgcctgaacaaccagcggctagcagcgccgccggtgcgactctgccggtctttggggct
cctgcaccggcttcgtcagagccctcctccgccaaggcgccctccgccacggtggctccc
ttacccagcgcaacctctggcctagcggaagcaccaaaaccctttgcgtttggccagcct
agcagcgccaacagcggaggaatcagtggaggaccagctgccaagccggctgtcttcaac
tttggtggaagtaccgctcaagtctcggcaccagcagctccacagccaaccgatctgttt
ggaggccagaacaaaccacaaagcaatacatttggtggagttttcgccgcgccgacggcc
gccaagccagagccggcgaagcccggaatttttggcagtcaggacaacagctttggaagt
gcattcaaaccatcagagcccatcaagcctttcccattcaatgagaccacacccgcggct
ggtggccccaaaccgtcttcgaatctctttacctttggaggagccacaacaccagcaaag
ccagatgcaccagctcccaacccctcaaccaatgtgtttggccaacccaagtccccagca
ccaacaccatttgctttctcgatgggatcaagcggtaatgccgagaaaccagtattcgct
tttggaggagtaggaggtggaggcgggggcggagatagtagcaaacccagttctgttttc
aacttcggtggtggtgacaagagcaacgcggctgcaactccatcggcagtatcttcagct
gccacttcgaccagcaacggctttgggttcagccaagtacagaagcccgcgacaccaatg
tttggatcgacatcgacacaggacaacaccaactctctgggcggctccaaaccttttaca
tttggaggagatgcccagcaggcggctggcccggcagcaggtggcttttcgttcgcctcg
gtggccaaaaaggccgaggaaccgaagcaaacaaacatattcggcagctccgccagtgct
agcaactcgacctttgcctttggaggaaacaacagcaacaaccaggctggaggaccaccg
gctgcggcgtctggaggcttctcctttgcggcagtggccgctaagaaggataagccggca
ggtaccaacttgtttggaaatccagctgctgctactgctgggatggcaaagccagctttc
aactttggaggaggcagtgcatccacacctcaagcggcacccagcttcggaggatttgga
gctgccgcctcacaggcaccctctgctgctgctgccccaccaactgctccgggtcacaac
aaaccctttgcgttcggacaaagcgctgcgggaccggctcccggcggcaacctgtttgcc
agtgcggtagccgccgcccaaaaccagccggcaaagccgcccagtttctcgtttggtgga
gcagccaatccaccagccagcaatgccaccggcaacgctccattctctttcggcggagcg
acagctggcggcatcgcttcccagcccagcaatcagagcatgaacacaccgaagcagttt
agtttcggcggcgccagcagcaatccggtacagagtgccttcggcagtccagctccgtcg
cccattccctcggcccagaatgcggctggaggagcgtacaactttggcggcggtcccgcc
acacccactcagccgggcaatgctggcggcatgggagtcggccagccacccggcactcca
gagaatcgtctgatacgcaaagctactcgacgcctgcagaaataa

DBGET integrated database retrieval system