KEGG   Drosophila ananassae: Dana_GF18511Help
Entry
Dana_GF18511      CDS       T01059                                 

Definition
GF18511 gene product from transcript GF18511-RA
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
dan  Drosophila ananassae
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dana_GF18511
Enzymes [BR:dan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dana_GF18511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 704 aa AA seqDB search
MILRHSNLWIFIWRRKLSFLLVVSGLVLLGLWTWAILIDTTYPPPTSAISAGTEQQQQQQ
DTGYQQVHIIQKLIAQANRVLRAERLKDNVAAQQLGNVRFLRPTQSKKGPLPLSESYLFE
QDRLKILEHQQRQKNANGMEELNAISEDERMLTSAERQTQYEHELQRMGVPVVAGIGPNG
PRAPTERLVHLDLKGAPPKLSFLKQLLPMLRALGATGLLIEYEDMFPYSGVLQPLAAHNA
YKEDELRDFLETAAVHGLSVMPLVQTFGHMEFVLKLSGFEQLRELTESPQSICPSQPQSM
ALLEQMLTQVIEFHLQCLGQSTPSSAAPPAAPIRFTHIHIGCDEVQRMGECSVCRQRLRS
ELFLSHVVSVAHFIRRHWPQLGVVIWDDQLRSMSLGELKHSQVGSYVEPMVWVYASDIYR
FIPPQLWDTYAKIFPSAWTASAFKGAFGESLMVPPLQHHLENNIRWLAVIAKEGGRFAKG
LRGIALTGWQRYDHFAVLCELLPVGIPSLMTSLSTVSKGYFSTNPRDNELLKVLQCVFQP
DSRRSGRPWLELHPNAHHSQLFSACSYPGHLVFKYAQRLFEKLAEIKLYLQQTKEQSAWL
SDYNVRHNFSSPLRVRELTARTPMLIEELRTMSREAQQLLWEVYDEHTVTEFVEQHIYPT
IVALQGQLASAESLLPTRTWPQRPLPLALKVQEDMGLVTDNQLH
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgatattgaggcactcaaatctgtggatatttatttggcgccgtaaactctccttcctg
ctcgtcgtgtctggcctggtgctgctcggcctctggacctgggccattttaatcgatacc
acatatccgccgccaacctccgccatctccgccggcactgagcagcagcagcagcagcag
gatactggataccagcaggttcacatcattcaaaagctaattgcccaggccaatcgagtc
ctaagggccgagcggctgaaggacaacgtagctgcccagcagctgggaaacgtgcgtttt
ctgcgacccacccagtccaagaaaggtccactgccgctgtccgaaagctacctatttgag
caggaccggctcaagatcctggagcatcagcaacgtcaaaagaacgccaacgggatggag
gaacttaatgccattagcgaggacgaacgaatgctcacctcggcggagcggcagacccag
tacgagcacgagctccagcgaatgggagtgcccgtagtggccggaatcggtccaaatgga
ccacgtgctccaaccgagcgtctggttcatcttgatcttaagggtgctccgccaaaactt
agcttcctcaagcaactactgcccatgctccgagccctgggagccactgggctgctcatc
gagtacgaggacatgtttccctattcgggggtactccaaccattggccgcgcacaatgcc
tacaaggaggacgaactgagggacttccttgagactgccgccgtccatggcttaagtgtt
atgcctctcgtccagacttttggacacatggagtttgttttgaagctttccgggttcgag
caactccgcgaactgacagagagtccgcagtcgatctgccccagccaaccgcagagtatg
gcactgttggagcaaatgcttacccaggtgattgagtttcacctgcagtgcctgggtcaa
tcgaccccttcgtcggcagctccacccgcagcacccatccgattcacgcacatccacatt
ggctgcgacgaggtccagaggatgggcgagtgctccgtctgccgccagaggctccgcagt
gaactgttcctctcgcacgtggtgagtgtggcgcatttcatccgtcgccactggccccag
ctgggcgtggtgatctgggacgaccagttgagatcgatgtccctcggtgagctgaagcac
tcccaggtaggcagctatgtagagccgatggtgtgggtctacgccagcgatatctatcgc
tttataccgccccagttgtgggacacatacgctaagatcttccccagcgcctggacggcg
tccgccttcaagggtgctttcggagagagcctgatggtgccgccgctgcaacatcatctg
gagaacaatatccgctggctggcggtgatcgccaaggagggtggccggtttgcaaaagga
ttgcggggaatagcactgaccggatggcagcggtatgatcactttgccgtgctctgcgaa
ctcttgcccgtgggtattcccagcctgatgacctcgctgtccacagtctccaagggttat
ttcagcacaaatcccagggataacgagcttctcaaggtgcttcagtgcgtcttccagccc
gatagccgacgttcgggtcgtccgtggctggaactgcaccccaacgcccatcacagccag
ctgttctcggcgtgcagctatcccggacacctggtcttcaagtatgcccagcgcttgttc
gaaaagctggccgagatcaagctctatttgcagcagacgaaggaacaaagtgcctggctc
tctgattacaatgtgcggcataacttcagctcgccgctgagggttcgggaattgactgcc
agaactccaatgctaatcgaggagctacgcactatgtctcgggaggctcaacagctgctg
tgggaagtctatgatgagcacacggtgaccgagtttgtggagcagcatatataccccacc
attgtggcgctccaggggcaactggccagtgcggaatcccttctcccgacacgcacctgg
ccccagagacctctccccctggccctgaaggtccaggaggacatgggactggtgacggat
aaccaactgcactga

DBGET integrated database retrieval system