KEGG   Drosophila ananassae: Dana_GF18646Help
Entry
Dana_GF18646      CDS       T01059                                 

Definition
GF18646 gene product from transcript GF18646-RA
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dana_GF18646
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 404 aa AA seqDB search
MAQIQEYQDLVLDALEVVDFKLIRDKGDINNDALIFHPAMAHQIFGESETIFGYKDLHVR
VLYTAGPLHIYLGVEYGNRVNEISGGEIKADDVISTIAQSLPDGCYFINLDEFLKTLDKA
DKFQPFGEKVNEYTRTSDDGSERLFEIYQCDYKISSFLKFFSRLQTFVLWFVDAASYIDT
DDPQWSFFVCYEKYKNNDGQWQYATAGYTTVYEYYAYPQNKRPRISQMLILPPFQKLGLA
TKLVETIYKFYQSQKNVVDITVEDPSEDFQRLRNFVDARFCKNLKSFSPDIISKGFTKEM
VREARETLKLNPRQVRKVYELLRLYYTNLNDEREYRAYRLEVKKRLNAVYYKQLKDLKKM
ERYKMDTEMLRARLPTMKQRMDQLQEEYTVVEQDYQNTIAKLKA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaattcaggaatatcaggacttggtcttggatgccttggaagtcgtggacttt
aagttgattcgggacaagggagacataaacaacgacgctttgattttccaccccgccatg
gcccatcagattttcggtgaatctgagactatattcggttacaaagatttgcatgtgcga
gtgctttatactgccggtcccttgcacatataccttggagtcgagtatggaaatcgagtg
aatgagatatctggtggagaaatcaaggctgacgatgttatcagcactattgcccagagt
ctgccagacgggtgctatttcatcaacctggacgagttcctgaagaccttggacaaagcc
gacaagtttcaacccttcggcgaaaaggttaatgagtatactcgcacatcggacgacgga
agcgagcggctctttgaaatataccaatgcgactacaaaatatcgtcattcctcaagttc
ttttcacgtctgcagacctttgttttgtggttcgtggatgcagcttcgtacatcgacacc
gatgacccacagtggtccttctttgtttgctatgaaaagtacaagaataacgatggtcag
tggcaatacgccactgcgggctataccaccgtttacgagtactacgcttacccgcaaaat
aagcgccctaggattagccagatgctgatattaccgccttttcagaagttgggccttgcc
actaagttggtggaaacaatttacaaattctaccagtctcaaaagaacgtggtggatatt
accgtagaggacccgtccgaagatttccagcgacttcgaaattttgtagatgctcgcttt
tgcaagaacttaaaatcattttcacccgatattatttcaaagggcttcacaaaagagatg
gttcgggaggctcgggaaacacttaaactgaatccccgccaggtgcggaaagtttacgag
ctattgcgcctatactataccaatttgaacgatgaacgggagtacagggcctaccggttg
gaggtcaagaaacgcctcaacgccgtatactataagcagctaaaagacttgaagaaaatg
gagcggtacaaaatggacacagagatgctaagggctcgcctgcccaccatgaaacagcga
atggatcaactacaagaggagtacacagtcgtggaacaagattatcagaacaccattgcc
aaactgaaagcctaa

DBGET integrated database retrieval system