KEGG   Drosophila ananassae: Dana_GF18667Help
Entry
Dana_GF18667      CDS       T01059                                 

Definition
GF18667 gene product from transcript GF18667-RA
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dan  Drosophila ananassae
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dan00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 304 aa AA seqDB search
MSAPIIMRLMASSISTAKRAGVIIRDVLKKGDLGIVDKGHNDPQTEADRSAQQCIIASLT
KKFPTVKIIGEEGCSDLNVCDDWLVTEQDESFLQHNCPAEWQDAKPEDFVIWVDPLDGTA
EYTQGFVEHVTVLIGIAVKDAAVGGIIHQPFYKQPDGELGRTIWGLKGVGTGGFTPKAAP
AGKFIITTTRSHSNALHQQALNAFPSAEVIKVGGAGFKVLQLLEGKAHAYVFATPGCKKW
DTCAPEAVLEAQGGTLTNINGEHYAYNADVEHVNKKGVLASLGQNHSDLVEKIPAEVRQA
VGAK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctcctattattatgcggcttatggcttcctccattagcacggccaagcgggcc
ggagtgatcatacgcgatgtgctgaaaaaaggcgacctgggaattgtggacaaaggccac
aacgatccccagacggaggccgaccgctccgctcagcagtgcatcattgcctcgttgacc
aagaaatttcctactgtgaagatcattggggaggagggatgttccgatctaaatgtgtgc
gacgattggctggtgaccgaacaggatgagtcgtttctgcagcacaactgtccggcggag
tggcaggatgccaagcctgaagattttgtcatatgggtggatccattggacggcaccgcg
gaatacacacaaggattcgttgagcatgttacggttctgattggaattgctgtcaaggat
gctgcggtgggcggaattattcatcagcccttctacaagcagcctgatggagagctgggc
cgcacaatttggggcctcaagggcgtaggaactgggggattcacaccaaaggcagcgcca
gctgggaagttcatcatcactaccactcgctcacattccaatgccttgcaccagcaagct
ctcaacgccttcccatccgccgaggtaataaaagtcgggggtgccggcttcaaagttttg
caactgctcgagggaaaggcgcatgcgtacgtgttcgccacgccaggatgcaagaaatgg
gacacctgcgcacccgaagccgtgctcgaagcccagggcggaaccctgaccaacatcaat
ggggagcactacgcctacaacgcggatgtggagcacgtgaataaaaagggagtattggcc
agtcttgggcaaaatcattccgatctggtagagaagattcccgcggaggtgcgtcaagca
gtgggagccaaataa

DBGET integrated database retrieval system