KEGG   Drosophila ananassae: Dana_GF18667Help
Entry
Dana_GF18667      CDS       T01059                                 

Definition
GF18667 gene product from transcript GF18667-RA
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dan  Drosophila ananassae
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dana_GF18667
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dana_GF18667
Transfer RNA biogenesis [BR:dan03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Dana_GF18667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 304 aa AA seqDB search
MSAPIIMRLMASSISTAKRAGVIIRDVLKKGDLGIVDKGHNDPQTEADRSAQQCIIASLT
KKFPTVKIIGEEGCSDLNVCDDWLVTEQDESFLQHNCPAEWQDAKPEDFVIWVDPLDGTA
EYTQGFVEHVTVLIGIAVKDAAVGGIIHQPFYKQPDGELGRTIWGLKGVGTGGFTPKAAP
AGKFIITTTRSHSNALHQQALNAFPSAEVIKVGGAGFKVLQLLEGKAHAYVFATPGCKKW
DTCAPEAVLEAQGGTLTNINGEHYAYNADVEHVNKKGVLASLGQNHSDLVEKIPAEVRQA
VGAK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctcctattattatgcggcttatggcttcctccattagcacggccaagcgggcc
ggagtgatcatacgcgatgtgctgaaaaaaggcgacctgggaattgtggacaaaggccac
aacgatccccagacggaggccgaccgctccgctcagcagtgcatcattgcctcgttgacc
aagaaatttcctactgtgaagatcattggggaggagggatgttccgatctaaatgtgtgc
gacgattggctggtgaccgaacaggatgagtcgtttctgcagcacaactgtccggcggag
tggcaggatgccaagcctgaagattttgtcatatgggtggatccattggacggcaccgcg
gaatacacacaaggattcgttgagcatgttacggttctgattggaattgctgtcaaggat
gctgcggtgggcggaattattcatcagcccttctacaagcagcctgatggagagctgggc
cgcacaatttggggcctcaagggcgtaggaactgggggattcacaccaaaggcagcgcca
gctgggaagttcatcatcactaccactcgctcacattccaatgccttgcaccagcaagct
ctcaacgccttcccatccgccgaggtaataaaagtcgggggtgccggcttcaaagttttg
caactgctcgagggaaaggcgcatgcgtacgtgttcgccacgccaggatgcaagaaatgg
gacacctgcgcacccgaagccgtgctcgaagcccagggcggaaccctgaccaacatcaat
ggggagcactacgcctacaacgcggatgtggagcacgtgaataaaaagggagtattggcc
agtcttgggcaaaatcattccgatctggtagagaagattcccgcggaggtgcgtcaagca
gtgggagccaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system