KEGG   Drosophila ananassae: Dana_GF18893Help
Entry
Dana_GF18893      CDS       T01059                                 

Definition
GF18893 gene product from transcript GF18893-RA
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dan  Drosophila ananassae
Pathway
FoxO signaling pathway
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dan00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dana_GF18893
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dana_GF18893
Protein kinases [BR:dan01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dana_GF18893
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 366 aa AA seqDB search
MSASKAQKFYKVDINRTEWEIPEMYQGLQPVGSGAYGQVSKALIRGTNMQVAIKKLARPF
QSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPHPANASLDSIQQVYLVTHLMDADLNNI
IRMQTLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTE
NEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIM
EMLGTPPDDFMKKISSESARSYIQSLPPMKRKSFKKVFEKANPLAIDLLEKMLELDAEKR
ITAEEALAHPYLEKYAEPSDEQTSPPYDHSFEDMDLPVDKWKELIYKEITNFKPPPSFAQ
VLKDVK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgtccaaggcccagaagttctacaaggttgacattaaccggacggaatgggag
atcccagaaatgtaccagggccttcagcctgtgggatcaggagcttatggccaagtttcc
aaggctttgataagaggaaccaacatgcaagtggccattaaaaagctggcacgccctttt
cagtccgccgtccacgccaaacggacgtacagggagctgcgacttcttaagcacatggat
catgagaatgtgatcggtttgctggacatattccatccgcatccggcgaatgcttcttta
gacagcatccagcaggtttatttggtcacccatctaatggacgccgaccttaacaacatt
attagaatgcaaaccctgtccgacgatcatgtccagtttttggtataccagattctcaga
ggtctgaagtatatccacagcgctggagtgatccaccgggatctgaagccttcgaatatt
gctgtgaacgaggactgtgagctgcgcatcctggattttgggttggctcgaccaacggag
aatgaaatgacgggctatgtggccaccagatggtaccgggctccggaaatcatgctgaac
tggatgcattacaaccagacggtggacatttggtcggtggggtgcattatggccgagcta
atcacgcggcgcacgcttttcccaggcactgaccacattcaccagctcaacctgattatg
gagatgctggggactcctccagacgatttcatgaagaagatctcttcggagagtgcgcgc
agctacattcaatcactgccacctatgaaaaggaaaagtttcaagaaggtcttcgaaaaa
gccaatccgctggccatcgatctgttggaaaagatgctggagctggacgctgagaagcgt
atcaccgccgaggaggccttggcgcatccatatctggagaagtacgcggagcctagtgac
gagcaaacatcgcctccgtacgatcacagcttcgaggacatggacttgccagtggataag
tggaaggagctgatctataaggaaataacgaacttcaagccaccgccatcatttgctcag
gtcctcaaggatgtcaaatga

DBGET integrated database retrieval system