KEGG   Drosophila ananassae: Dana_GF18893Help
Entry
Dana_GF18893      CDS       T01059                                 

Definition
GF18893 gene product from transcript GF18893-RA
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dan  Drosophila ananassae
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dan04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 366 aa AA seqDB search
MSASKAQKFYKVDINRTEWEIPEMYQGLQPVGSGAYGQVSKALIRGTNMQVAIKKLARPF
QSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPHPANASLDSIQQVYLVTHLMDADLNNI
IRMQTLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTE
NEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIM
EMLGTPPDDFMKKISSESARSYIQSLPPMKRKSFKKVFEKANPLAIDLLEKMLELDAEKR
ITAEEALAHPYLEKYAEPSDEQTSPPYDHSFEDMDLPVDKWKELIYKEITNFKPPPSFAQ
VLKDVK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgtccaaggcccagaagttctacaaggttgacattaaccggacggaatgggag
atcccagaaatgtaccagggccttcagcctgtgggatcaggagcttatggccaagtttcc
aaggctttgataagaggaaccaacatgcaagtggccattaaaaagctggcacgccctttt
cagtccgccgtccacgccaaacggacgtacagggagctgcgacttcttaagcacatggat
catgagaatgtgatcggtttgctggacatattccatccgcatccggcgaatgcttcttta
gacagcatccagcaggtttatttggtcacccatctaatggacgccgaccttaacaacatt
attagaatgcaaaccctgtccgacgatcatgtccagtttttggtataccagattctcaga
ggtctgaagtatatccacagcgctggagtgatccaccgggatctgaagccttcgaatatt
gctgtgaacgaggactgtgagctgcgcatcctggattttgggttggctcgaccaacggag
aatgaaatgacgggctatgtggccaccagatggtaccgggctccggaaatcatgctgaac
tggatgcattacaaccagacggtggacatttggtcggtggggtgcattatggccgagcta
atcacgcggcgcacgcttttcccaggcactgaccacattcaccagctcaacctgattatg
gagatgctggggactcctccagacgatttcatgaagaagatctcttcggagagtgcgcgc
agctacattcaatcactgccacctatgaaaaggaaaagtttcaagaaggtcttcgaaaaa
gccaatccgctggccatcgatctgttggaaaagatgctggagctggacgctgagaagcgt
atcaccgccgaggaggccttggcgcatccatatctggagaagtacgcggagcctagtgac
gagcaaacatcgcctccgtacgatcacagcttcgaggacatggacttgccagtggataag
tggaaggagctgatctataaggaaataacgaacttcaagccaccgccatcatttgctcag
gtcctcaaggatgtcaaatga

DBGET integrated database retrieval system