KEGG   Drosophila ananassae: Dana_GF18894Help
Entry
Dana_GF18894      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
dan  Drosophila ananassae
Pathway
dan04013  MAPK signaling pathway - fly
dan04068  FoxO signaling pathway
dan04624  Toll and Imd signaling pathway
dan04933  AGE-RAGE signaling pathway in diabetic complications
Module
dan_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dan00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dana_GF18894
   04068 FoxO signaling pathway
    Dana_GF18894
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    Dana_GF18894
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dana_GF18894
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dana_GF18894
Protein kinases [BR:dan01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Dana_GF18894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase APH Kdo
Motif
Other DBs
NCBI-GeneID: 6501659
NCBI-ProteinID: XP_001955701
FlyBase: FBgn0095908
UniProt: B3M0L5
Position
Unknown
AA seq 365 aa AA seqDB search
MPGFHSVEVNNRNWVIPDIYEVLEPLGRGSFGQVAKVQLRNTNIQVAMKKLLTPFESEED
AKRVYREIKLLKHMNHRNVISLLDVFHGPSPNPNPTLDDFQEVYLVTDLMYKDLHRVTRE
VRLSERQVKFILFQILKGLKHIHSAGVLHRDLKPGNIAVNENCELRILDFGMARLLSMDM
TDRVCTLWYRAPEILFGWGQYTKAIDMWSVGCILAELISGRPLFPGTRRDQIMVVIEVMG
KPSEEFVSGISDPYARQYLDRIPPRERRNFREIFPDANPNALDLLEKMLDMIPQNRITVE
EALNHSYFKGFSDPYFLEDDTAQPYDQNFENMNLPINCWKELILTEIRNFIPPPCFQGPL
RESYQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcctggatttcatagtgtggaagttaataacagaaattgggtgatccccgatatttac
gaagttttggagcccctgggcaggggatcatttggccaggtggccaaggtacagctgcgt
aacacaaacattcaggtggccatgaaaaagttactgacacccttcgaatcggaggaggat
gcaaagagggtttatcgggagataaagctgctgaagcacatgaatcaccgtaacgttatc
agtttgcttgacgtatttcatggaccttcaccaaatcccaatccaacgttggacgacttc
caggaggtttatttggtgactgacttgatgtataaagatttgcaccgagttacgcgcgaa
gtgaggctctccgaaagacaggtgaagttcattctcttccagattttgaagggtctgaaa
catatccatagcgccggtgtcctgcaccgggatttgaagcctggaaacatcgctgtgaac
gagaactgtgaactccgcattctggatttcggtatggctaggctgttatcaatggacatg
acggatcgggtgtgtactttatggtaccgtgcaccggaaatcctgtttggatggggtcaa
tacaccaaagctattgatatgtggtcagtgggttgcatcctagcggagctaatctcgggt
cgcccccttttccctggcacgagacgagatcaaatcatggtcgttattgaagtaatgggg
aagccttcggaagaatttgttagcggtattagcgatccctatgctcgtcagtacttggat
cgaattccacccagagaacggaggaacttccgtgaaattttcccagatgcaaaccctaat
gctttggatttgttggagaaaatgttggatatgattccccaaaatcgtataaccgtggaa
gaggcattgaaccattcgtatttcaaaggtttttctgatccatatttccttgaggatgat
actgcacagccttatgatcaaaattttgagaacatgaacttgccgataaactgctggaag
gaacttattcttaccgagataagaaattttatacccccgccttgttttcaagggcctttg
agggagtcgtaccaatag

DBGET integrated database retrieval system