KEGG   Drosophila ananassae: Dana_GF18894Help
Entry
Dana_GF18894      CDS       T01059                                 

Definition
GF18894 gene product from transcript GF18894-RA
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dan  Drosophila ananassae
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dan04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 365 aa AA seqDB search
MPGFHSVEVNNRNWVIPDIYEVLEPLGRGSFGQVAKVQLRNTNIQVAMKKLLTPFESEED
AKRVYREIKLLKHMNHRNVISLLDVFHGPSPNPNPTLDDFQEVYLVTDLMYKDLHRVTRE
VRLSERQVKFILFQILKGLKHIHSAGVLHRDLKPGNIAVNENCELRILDFGMARLLSMDM
TDRVCTLWYRAPEILFGWGQYTKAIDMWSVGCILAELISGRPLFPGTRRDQIMVVIEVMG
KPSEEFVSGISDPYARQYLDRIPPRERRNFREIFPDANPNALDLLEKMLDMIPQNRITVE
EALNHSYFKGFSDPYFLEDDTAQPYDQNFENMNLPINCWKELILTEIRNFIPPPCFQGPL
RESYQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcctggatttcatagtgtggaagttaataacagaaattgggtgatccccgatatttac
gaagttttggagcccctgggcaggggatcatttggccaggtggccaaggtacagctgcgt
aacacaaacattcaggtggccatgaaaaagttactgacacccttcgaatcggaggaggat
gcaaagagggtttatcgggagataaagctgctgaagcacatgaatcaccgtaacgttatc
agtttgcttgacgtatttcatggaccttcaccaaatcccaatccaacgttggacgacttc
caggaggtttatttggtgactgacttgatgtataaagatttgcaccgagttacgcgcgaa
gtgaggctctccgaaagacaggtgaagttcattctcttccagattttgaagggtctgaaa
catatccatagcgccggtgtcctgcaccgggatttgaagcctggaaacatcgctgtgaac
gagaactgtgaactccgcattctggatttcggtatggctaggctgttatcaatggacatg
acggatcgggtgtgtactttatggtaccgtgcaccggaaatcctgtttggatggggtcaa
tacaccaaagctattgatatgtggtcagtgggttgcatcctagcggagctaatctcgggt
cgcccccttttccctggcacgagacgagatcaaatcatggtcgttattgaagtaatgggg
aagccttcggaagaatttgttagcggtattagcgatccctatgctcgtcagtacttggat
cgaattccacccagagaacggaggaacttccgtgaaattttcccagatgcaaaccctaat
gctttggatttgttggagaaaatgttggatatgattccccaaaatcgtataaccgtggaa
gaggcattgaaccattcgtatttcaaaggtttttctgatccatatttccttgaggatgat
actgcacagccttatgatcaaaattttgagaacatgaacttgccgataaactgctggaag
gaacttattcttaccgagataagaaattttatacccccgccttgttttcaagggcctttg
agggagtcgtaccaatag

DBGET integrated database retrieval system