KEGG   Drosophila ananassae: Dana_GF19013Help
Entry
Dana_GF19013      CDS       T01059                                 

Definition
(RefSeq) GF19013 gene product from transcript GF19013-RN
  KO
K15293  
protein unc-13 A/B/C
Organism
dan  Drosophila ananassae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 2761 aa AA seqDB search
MTDYAMLNNENGALSSDTDRPTYSHISYGTNFSRKNYKDLWQYQEIEECGREINKTINSV
PIIDNHSYAYNYLDCYKGEDPHDASVDNWDGVESWDSTEVVAVEYSFEYSNPRCTSSKLL
PMLPVKQTNTGASELSAAMDLKIEDLEATKDLLKSNRIAQLGGVSVESSTCAWGQTMRPY
TSMLPLDYKNEDSLSTYSDTPPTNHDQLKLQQQRKISLMMAMTTASVIASGETRVPVQSK
HIKKPTHNHIDFLLDNSNSSPKGTSESLFEPENCSRRTHAQSDVDAVENPLLDANSTNPK
TRKLPKLLPTPQYKSPLHTPVSTIEKVDTFNLPLYSSPPITEKIHRAKQLPKLPISTNQT
ISHSISSTAPIKSVKSSKEMELSLVSLKNVSIENSIMTHDPKESNIMADLQRINEHISSQ
VPLESNIYKSVESLYNDKISFPPTCNSMRGETTNSVSKIDLKETYLRNQYILESTELLDT
CVAEPEEVSDNISEYRTPYTLDICFSEEQQYHSDTITSNIEPYYVKGGKNSTEGIFSQAE
QINACVNYEICENFSENRVSTSTYPSLIQHESVQPSTVYTSIDEFSSNSNDVKINSIVTS
QSMQIPISHDINATTGFNCTQNAFTKSVYVNNASVMAETISRDVSPSPSTLTLTSPSSMA
PILSYSDYMKQFELPDLPQPIIPLTATVSIEQGDTGPINNIGISKNVDNTPDSSIIDATT
KFKENLSTELIEEFQTTSQDSQTNNYKKDPPNSASLVQNTTIECSVEPTTSTIFMTDSER
PMYHALSFDDSFYDSFNVDLKKLTASIACQHIETGLFKNTQLNENYNTDLHFSETNKLSI
EPRDLNQNLQHGLGGNSPSQPNNPKFLSDPIQQTNIAVSSKASSVFGGLSKGLKGGLDGV
FNSVASTVDATPQVNSKKVFGLNLSSKLVPSVGELIYNSNSGGNKQSETEPKFFTATEIF
LNANPNMMDSNTSPILYDNKDHRFNVTEMPIDILPLEVYNNETMSTNSILVEKQNDNFNE
SHDEMILSEQEIRQNQQEIAYGTCVKQNQIVNDYATSFAQNNYESICTQQKVTDTPIKDH
ITKKNNTAGSMIGSILGKAAAAVQTATQVVNQSASSVASVMIQKQSTNTLTVVESSNIIV
PADLRDSNKLNDINLEYYEYSMSNEVTNRTDFTNIGGDYENSNFQFGTDVDNKSLSYLGT
NGNQTQLVVGSDTTGKTNEIGNGSKILPMVPPASISKKLPIINGKMGLLTKQMPTEIYDD
EFDLDEMEVNSTGKETGFCIDSKHDDYSLKLQQTLSQQSNSYYEPINSGYNYREDYFNEE
DEYKYLEQQEQQKKMPSCIQQVDETESVLLNKQPSSSSEYIIEGRDTDLIYENYQSEEES
LTYLDESSSGSVEPIESKKSIQMNGGERKDSNGKTSITNINISLQLPSYQHIQENESTFD
KPKLNRSQEQICMDSFEKYEELNDQLSDLSDLRKITSTRKKPLIRGETEEVVGGHMQMIR
HSEVTAKQRWHWALNKVILQLNNGIGAGDVGIRTNGHPGDNPFYSNIDSMPDIRPRRKSI
PLVSELTMAATKRNAGLTSAVPRATLNDEELKMHVYKKALQALIYPISSTTPHNFLLWTA
TSPTYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKAH
SIITAMKDRMKQREREKPEIFELIRMTFGVDPDTHIDSLEQAEHATVEGTSKWSCKLTIT
VICAQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVR
VWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLH
ISVEIKGEEKVAPYHVQYTCLHENLFHYLCEENSGMVKLPIQKGDDAWKLYFDEIPEEIV
DEFSMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDR
FAASNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSSEKLMDLKSTVDLLTSITFFRMK
VQELSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNEVKRAPDDHEPKLD
SVDFWHKLIALIVSVIDEDKNSYGAVLNQFPQELNIGQLSASSMWHLFAVDMKYALEEHE
QHRLCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEY
LHGAFKRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMRRFAK
TIVKVLIAYANIVKIEFPDHLKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANI
LKELQQNLNSSLDDLASQFAISLEPRITQSVRELGDMLLSIKGGSGNLAATNQAIQRNAV
AVEADEVLRPLMDLLDGSLTLYAQTCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTM
MFKHLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAV
LDVALDTIKQYFHAGGNGLKKTFLEKSSELQSLRYALSLYTQMTDTLIKTFISSQTHEVD
PENAEESVGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVEINLIGPHL
QEKKRKFATKSKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCFARDDRLVGVAVI
PLKDVSEKGSVACWLPLMRRIEMDETGWTILRILSQRNNDEVAKEFVKLKSEIRQDPTIG
S
NT seq 8286 nt NT seq  +upstreamnt  +downstreamnt
atgacggactatgcaatgcttaataatgaaaacggtgccttatcctcagacaccgatcga
ccaacttacagtcacatttcttatgggacgaatttcagtagaaaaaactataaagatttg
tggcagtatcaagaaatagaggaatgtggtcgtgaaataaataaaacaattaattctgta
cctattatagataatcatagttatgcttacaattatttagactgctataaaggagaagat
ccccacgatgcttcagtcgataactgggatggtgtggaaagctgggacagtacagaagtt
gttgcagttgaatacagttttgaatattcaaacccaaggtgtacctcctccaaactattg
cctatgcttccagttaagcaaactaatactggggcatcggaactaagtgctgcaatggac
ttaaaaattgaagatctagaagctacaaaagatctgctgaaaagcaatcgtatagcccaa
ctcggcggggtcagtgttgagtccagcacatgcgcttgggggcaaacaatgagaccatat
acctctatgttgcctttagattataagaacgaagatagtctttcaacctatagtgatacc
ccgccgactaaccatgatcaattaaaattacaacagcagaggaaaatttctttaatgatg
gcgatgacaacggcttctgtgatagcatccggtgagactagagtaccggttcaatctaag
catattaaaaaaccaactcacaaccacatagactttcttctagacaatagcaactccagc
ccaaaaggaacttcagaaagtttgtttgagccagagaactgtagcaggagaactcatgcg
caaagtgacgttgatgctgtggaaaaccctcttttagacgcaaattcgacgaacccaaag
actagaaaattgccaaaacttttaccaactccacagtataagtccccacttcatacaccc
gtttctaccattgaaaaagttgatactttcaatttaccattatattcgtctcctcctata
acagagaaaattcatcgcgccaagcagcttccaaagttgccaatttccacaaatcagacc
atttcacattcaatatcatcaactgcccccatcaaatctgtcaaatccagcaaagaaatg
gagctgtcattagtatcgttaaaaaatgttagtatagaaaattcgattatgactcatgac
ccaaaagaatcaaatattatggctgatttacaacggattaatgaacatatttcatcacaa
gtaccattagaatcaaatatctacaaatccgtggaaagcttatataatgacaaaatttcg
ttcccgccaacatgcaattccatgagaggagaaactacaaattctgtcagtaaaatcgat
ttaaaagaaacgtatttaagaaatcaatatattttagaatctacagaattgctcgacacc
tgtgtcgctgagcctgaagaagtctccgataatatatctgaatatcggacgccttataca
ttggacatatgtttttcagaagaacaacaatatcattccgatactattacttctaatata
gaaccctattacgttaaaggtggaaaaaattcaaccgaaggtatttttagccaagctgag
caaattaatgcttgtgtcaattacgaaatttgtgagaatttttcggagaatcgagtttct
acatcaacatacccgagcttaattcaacatgaatcagttcaaccatcaacagtctatacc
tcaattgatgagttttcttctaatagtaacgatgtcaaaattaactcaatcgtaacatca
caatcgatgcaaatccctataagtcacgacataaatgcaactacgggttttaattgcact
cagaacgcattcacaaaatctgtttatgtaaataatgcctcagttatggctgaaactatt
agccgagatgtttccccttctccttccacactaacgttaacatcaccctcatcaatggct
cctatattatcttacagtgactatatgaaacaatttgaattaccagatttgccgcaacca
attattccactaacagccactgtctctattgaacagggtgatacgggacctatcaacaat
attggcatttcaaaaaatgttgataatacacctgattctagcataattgacgcaacaacc
aaatttaaagaaaacttatcaactgaactcattgaagaatttcaaacaaccagccaagat
tcgcaaaccaacaattacaaaaaggatccaccgaatagcgcatcacttgtacaaaatacc
accattgaatgttcagtagagccgaccactagcactattttcatgaccgacagtgagcgg
cctatgtaccatgctttatcattcgacgactcattttatgacagttttaatgtcgatctt
aaaaaactgacggcatctattgcctgtcagcatattgaaactggtttatttaagaatact
caattaaatgagaattataatacagatttacattttagtgaaactaataaacttagtatt
gagcctagggacttaaatcagaacctccagcatggattaggtgggaattctccatcgcag
ccaaataatccgaaatttttaagtgatcccattcaacaaacgaatatagccgtttcttct
aaggcatcaagtgtattcggtggactatctaaaggtttaaaaggtggtctagatggagta
tttaatagtgtcgcttcaactgtagatgccactccacaggtgaacagcaaaaaagttttt
ggcttaaacttatcatcaaaattagtccctagtgttggtgagttaatctacaattccaac
tcaggcggaaataaacaatcagaaacagaaccaaaattttttacagcaactgaaatattt
ttgaacgctaatccaaatatgatggattccaacacatcccccattctttatgataataaa
gaccatagatttaatgtaacagaaatgccgattgacattcttcccttagaggtttataat
aatgagacaatgtcgacaaattctattttggtagaaaaacagaacgataacttcaatgaa
agtcacgatgagatgattttgagtgagcaagagattcgtcaaaatcaacaagagatagca
tatggtacatgtgtaaaacaaaatcaaatagttaatgactatgcaacttcttttgcacaa
aataattatgaatctatatgtacacaacaaaaagttacagacacacctattaaagatcat
ataacgaaaaaaaataacacagcaggtagcatgataggatctattttggggaaagcagct
gcagctgttcaaacagccacgcaagttgttaatcaaagtgcatcctcggtagcttcagtt
atgatacagaaacaatccacaaacacattaactgttgttgaatcgtcaaatataattgtt
cccgcagacttaagagactcaaataaattaaatgacattaatttagaatattatgaatat
tctatgtccaatgaagttactaatcgtaccgatttcacaaatattgggggcgattatgag
aatagtaattttcaattcggtacagatgtagataacaaatcactctcctatttgggtacc
aatggtaatcagacgcagctagtagttggctcggataccactggaaagacaaatgagatt
ggaaatggttcgaaaatattacctatggtacctcccgcatccatcagtaaaaaacttcca
ataattaatggcaagatgggcttgctcacaaagcaaatgccaaccgagatatacgatgat
gaatttgatttagatgaaatggaagtaaattcaaccggaaaggaaactgggttttgcatc
gatagtaaacatgatgattactccttgaaacttcagcagaccctctcgcaacaatcgaac
agttattatgaacccattaatagcggttataactacagagaggattacttcaatgaggag
gatgagtataaatatctcgaacagcaagagcagcagaaaaaaatgccaagttgtattcag
caggtagatgagactgaaagtgttttattaaataaacaaccatcctcatcatctgaatac
attattgaaggccgagatacagacttaatatatgaaaattatcaaagtgaagaagaaagt
ttaacttatctagatgaaagctcaagtggtagtgttgagcccattgaaagtaaaaaaagt
atacaaatgaatggaggagagcggaaagattccaatggaaaaacgtcgattactaatata
aatatttcactacaattgccatcgtatcaacatattcaagagaatgaaagtacttttgat
aaacccaagttaaatcgcagccaagaacagatttgcatggattcatttgaaaaatatgaa
gaactaaatgatcagctttccgatctttctgatttaagaaaaattacgtcgacgaggaag
aaacctcttatacggggtgaaaccgaagaagttgtaggtggacatatgcaaatgatacgc
cattctgaagttacagctaaacaacgatggcattgggctttgaataaagttatattgcaa
ctaaataatggcattggcgctggagatgttggaatacgaacaaacggacatcctggcgat
aaccccttttacagtaatattgacagtatgcctgatatacgacctcgaagaaaatcaatt
cctcttgtttctgaactgacgatggccgctacaaaacgaaatgctggactgacatccgcc
gttccacgagcaacactcaacgacgaagagttgaaaatgcacgtttataaaaaagcgctg
caggcgttgatctaccccatttcatcaacaacacctcacaactttttgttgtggacggct
acatcgccaacatattgttacgagtgtgaaggcttactgtggggaatagcaaggcaaggt
gtcagatgtactgaatgtggagtgaagtgccatgaaaagtgcaaggatcttttaaatgcc
gactgccttcaacgtgctgctgaaaagagctctaaacacggagctgaggataaagctcat
tcaattataaccgctatgaaggatcgtatgaagcaacgagaacgagaaaaacccgaaatt
ttcgaattaattaggatgactttcggtgtggatccagatacacacatagattcattagaa
caggctgagcacgctactgttgagggaacatctaaatggtcatgcaaactaacaattaca
gtgatttgtgctcaaggcctgatagcgaaggataaaagcggtaccagtgatccatatgtg
acggtgcaggttagcaaagtcaaaaaacgaacgcggacaatgccacaggaactaaaccct
gtgtggaatgagaagtttcactttgagtgtcataactcctctgatcgcataaaagtgcgc
gtttgggatgaagacaatgatttaaagtcaaaacttcgacaaaaattgacacgagagtca
gacgactttttaggacaaacgattatcgaagttcgtacactttctggcgaaatggatgta
tggtataatctggagaagcgaactgataaatctgctgtttctggcgcaatacgactacat
atatcagtggaaataaagggcgaggaaaaggtggctccttatcatgtgcaatacacttgc
ttgcatgagaatctttttcattatctttgtgaagaaaatagtggaatggttaaattgcca
atccaaaaaggcgatgacgcttggaaactttatttcgatgaaattcctgaggagattgtt
gatgagttttcaatgcggtatggaattgaaaacatttatcaagctatgactcactttcat
tgcctctcggccaaatacttgtgtcctggagtaccagctgtaatgagcacactattggca
aacattaacgcttattatgcgcatacaacagcatcctctgcagtatctgcaagtgatcgg
tttgcagctagcaattttgggaaagaaaaatttgttaagttattagatcagctacacaac
tcactcagaattgatttgtcaatgtatagaaataatttccccgcatccagttctgaaaaa
ctaatggacttaaagtcgaccgtcgatttattgacaagtataactttttttcgcatgaag
gttcaggaattgtcgagtccacctagggccagcactgttgtcaaagattgtgtaaaggca
tgtcttcggtcaacttatcaattcctttttgagaattgctacgaactttacaaccgagag
tttcaggtcgatcctaacgaagttaagcgtgccccagatgatcatgaacccaaattggac
agtgtggacttctggcataaactaatagcactcatcgtgtcagttatagatgaggacaaa
aacagctatggcgcagttttaaatcagtttccccaagaactcaatattggacaattatcg
gcatcttcgatgtggcatcttttcgctgtggatatgaaatacgccttagaagagcatgaa
caacatcgtttatgcaagtcgtcggcttatatgaatctccattttagagttaaatggctt
tatagtaactatgttaaagaagttcctccgtacaagggtgcggtaccggactatccagct
tggtttgaacctttcgttatgcagtggctaaatgaaaatgatgatgtatcattggagtat
ttgcacggtgcatttaaaagggataaaaaggatgggtttcaaaaaagcagcgagcacgca
ctattttcgaattcggtggtcgatgtttttacgcaattgactcaatgtttcgatgttgtt
agcaaactcgagtgtcctgatccagaaatttggaaacgttacatgaggcgttttgctaaa
acaatcgtaaaagttttaatagcttatgctaatattgtaaaaattgagtttccagatcat
ttgaaggatgaaagaatagcatgtatccttatgaacaatattcaacaactacgagttcaa
ttggaaaaaatgtttgagtccatgggtggggataagttagaagaagacgcagctaacatt
ttgaaggaactacaacaaaatttaaattcttctctggatgatttggcttcacaattcgct
atcagtttggaacctcgtattacccagtccgtccgtgaactaggggacatgcttctatct
attaagggaggaagcggaaatcttgcagctactaaccaagcaattcaacgcaatgcggtc
gccgttgaagccgatgaagttttaagaccactgatggatttgttggatggctcattaaca
ctgtatgcccaaacatgtgaaaaaactgttctaaagaggttacttaaggagttgtggaaa
attgttatgcgaatattggaaaaaacaatcgttctaccaccaatgactgacaaaacaatg
atgtttaagcacttgactgataatgcaaaaaatttggcatccaatgctaaaatagaagac
atgggtcgactattcaaatctcacatggcaggaaaacaagatgttaaaagtgcgcttagc
ggagtaatggacatatctaaggaagtcgaaaaaaatttgtcgcctaaacagtgtgccgtg
ctggatgttgccttagatacaataaaacaatatttccacgctggaggaaatggattaaaa
aagacgtttttagaaaaatcatcggagctacaaagcttgcgttatgcactcagtctatat
acacaaatgacagacactttaatcaaaacatttatatctagccaaactcatgaggtagat
cctgaaaacgcagaagaaagtgttggggaaatttccgtgcaaattgacttgttctctcat
ccaggcacgggagaacacaaagtgaacgtaaaagttgttgcagctaacgatctcaaatgg
caaataccttcaggaatgttcagaccgtttgtggaaataaatttaatcggacctcatctc
caagaaaaaaagagaaaatttgcaacaaagtcaaagtcaaataattggtcaccaaaatat
aatgagtcattcagctttacaatcggtaatgaggaacagctggacttctttgaattacac
atttgcgtaaaagactattgctttgctcgtgatgaccgacttgtaggagtagctgttatt
ccactaaaggacgtttcagaaaagggttctgtcgcatgttggttacctttaatgagacgt
attgaaatggatgaaacaggatggacaattttaaggatattgtcccaacgcaataatgat
gaagtagccaaagaatttgttaagctgaaatcggaaatacgccaggatccaaccatcggc
tcttaa

DBGET integrated database retrieval system