KEGG   Drosophila ananassae: Dana_GF19013Help
Entry
Dana_GF19013      CDS       T01059                                 

Definition
GF19013 gene product from transcript GF19013-RA
Orthology
K15293  
protein unc-13
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2824 aa AA seqDB search
MLNNENGALSSDTDRPTYSHISYGTNFSRKNYKDLWQYQEIEECGREINKTINSVPIIDN
HSYAYNYLDCYKGEDPHDASVDNWDGVESWDSTEVVAVEYSFEYSNPRCTSSKLLPMLPV
KQTNTGASELSAAMDLKIEGMCIKREKRNGACTANPKKTVNVHSNNCYEYQDGYSSTFLK
NRALAAPSRALEQSSFYSHQGLFGFTTDLEATKDLLKSNRIAQLGGVSVESSTCAWGQTM
RPYTSMLPLDYKNEDSLSTYSDTPPTNHDQLKLQQQRKISLMMAMTTASVIASGETRVPV
QSKHIKKPTHNHIDFLLDNSNSSPKGTSESLFEPENCSRRTHAQSDVDAVENPLLDANST
NPKTRKLPKLLPTPQYKSPLHTPVSTIEKVDTFNLPLYSSPPITEKIHRAKQLPKLPIST
NQTISHSISSTAPIKSVKSSKEMELSLVSLKNVSIENSIMTHDPKESNIMADLQRINEHI
SSQVPLESNIYKSVESLYNDKISFPPTCNSMRGETTNSVSKIDLKETYLRNQYILESTEL
LDTCVAEPEEVSDNISEYRTPYTLDICFSEEQQYHSDTITSNIEPYYVKGGKNSTEGIFS
QAEQINACVNYEICENFSENRVSTSTYPSLIQHESVQPSTVYTSIDEFSSNSNDVKINSI
VTSQSMQIPISHDINATTGFNCTQNAFTKSVYVNNASVMAETISRDVSPSPSTLTLTSPS
SMAPILSYSDYMKQFELPDLPQPIIPLTATVSIEQGDTGPINNIGISKNVDNTPDSSIID
ATTKFKENLSTELIEEFQTTSQDSQTNNYKKDPPNSASLVQNTTIECSVEPTTSTIFMTD
SERPMYHALSFDDSFYDSFNVDLKKLTASIACQHIETGLFKNTQLNENYNTDLHFSETNK
LSIEPRDLNQNLQHGLGGNSPSQPNNPKFLSDPIQQTNIAVSSKASSVFGGLSKGLKGGL
DGVFNSVASTVDATPQVNSKKVFGLNLSSKLVPSVGELIYNSNSGGNKQSETEPKFFTAT
EIFLNANPNMMDSNTSPILYDNKDHRFNVTEMPIDILPLEVYNNETMSTNSILVEKQNDN
FNESHDEMILSEQEIRQNQQEIAYGTCVKQNQIVNDYATSFAQNNYESICTQQKVTDTPI
KDHITKKNNTAGSMIGSILGKAAAAVQTATQVVNQSASSVASVMIQKQSTNTLTVVESSN
IIVPADLRDSNKLNDINLEYYEYSMSNEVTNRTDFTNIGGDYENSNFQFGTDVDNKSLSY
LGTNGNQTQLVVGSDTTGKTNEIGNGSKILPMVPPASISKKLPIINGKMGLLTKQMPTEI
YDDEFDLDEMEVNSTGKETGFCIDSKHDDYSLKLQQTLSQQSNSYYEPINSGYNYREDYF
NEEDEYKYLEQQEQQKKMPSCIQQVDETESVLLNKQPSSSSEYIIEGRDTDLIYENYQSE
EESLTYLDESSSGSVEPIESKKSIQMNGGERKDSNGKTSITNINISLQLPSYQHIQENES
TFDKPKLNRSQEQICMDSFEKYEELNDQLSDLSDLRKITSTRKKPLIRGETEEVVGGHMQ
MIRHSEVTAKQRWHWALNKVILQLNNGIGAGDVGIRTNGHPGDNPFYSNIDSMPDIRPRR
KSIPLVSELTMAATKRNAGLTSAVPRATLNDEELKMHVYKKALQALIYPISSTTPHNFLL
WTATSPTYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAED
KAHSIITAMKDRMKQREREKPEIFELIRMTFGVDPDTHIDSLEQAEHATVEGTSKWSCKL
TITVICAQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRI
KVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAI
RLHISVEIKGEEKVAPYHVQYTCLHENLFHYLCEENSGMVKLPIQKGDDAWKLYFDEIPE
EIVDEFSMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSA
SDRFAASNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSSEKLMDLKSTVDLLTSITFF
RMKVQELSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNEVKRAPDDHEP
KLDSVDFWHKLIALIVSVIDEDKNSYGAVLNQFPQELNIGQLSASSMWHLFAVDMKYALE
EHEQHRLCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVS
LEYLHGAFKRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMRR
FAKTIVKVLIAYANIVKIEFPDHLKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDA
ANILKELQQNLNSSLDDLASQFAISLEPRITQSVRELGDMLLSIKGGSGNLAATNQAIQR
NAVAVEADEVLRPLMDLLDGSLTLYAQTCEKTVLKRLLKELWKIVMRILEKTIVLPPMTD
KTMMFKHLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQ
CAVLDVALDTIKQYFHAGGNGLKKTFLEKSSELQSLRYALSLYTQMTDTLIKTFISSQTH
EVDPENAEESVGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVEINLIG
PHLQEKKRKFATKSKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCFARDDRLVGV
AVIPLKDVSEKGSVACWLPLMRRIEMDETGWTILRILSQRNNDEVAKEFVKLKSEIRQDP
TIGS
NT seq 8475 nt NT seq  +upstreamnt  +downstreamnt
atgcttaataatgaaaacggtgccttatcctcagacaccgatcgaccaacttacagtcac
atttcttatgggacgaatttcagtagaaaaaactataaagatttgtggcagtatcaagaa
atagaggaatgtggtcgtgaaataaataaaacaattaattctgtacctattatagataat
catagttatgcttacaattatttagactgctataaaggagaagatccccacgatgcttca
gtcgataactgggatggtgtggaaagctgggacagtacagaagttgttgcagttgaatac
agttttgaatattcaaacccaaggtgtacctcctccaaactattgcctatgcttccagtt
aagcaaactaatactggggcatcggaactaagtgctgcaatggacttaaaaattgaaggt
atgtgcataaaaagagaaaaacgcaatggtgcctgtacggccaacccaaaaaaaactgta
aatgtacactctaataattgttatgaatatcaagatggctattcatcgactttcttaaaa
aatagagccttagcggcaccatcgcgggcattggagcaatcaagcttctactcacaccaa
ggtttatttggattcaccacagatctagaagctacaaaagatctgctgaaaagcaatcgt
atagcccaactcggcggggtcagtgttgagtccagcacatgcgcttgggggcaaacaatg
agaccatatacctctatgttgcctttagattataagaacgaagatagtctttcaacctat
agtgataccccgccgactaaccatgatcaattaaaattacaacagcagaggaaaatttct
ttaatgatggcgatgacaacggcttctgtgatagcatccggtgagactagagtaccggtt
caatctaagcatattaaaaaaccaactcacaaccacatagactttcttctagacaatagc
aactccagcccaaaaggaacttcagaaagtttgtttgagccagagaactgtagcaggaga
actcatgcgcaaagtgacgttgatgctgtggaaaaccctcttttagacgcaaattcgacg
aacccaaagactagaaaattgccaaaacttttaccaactccacagtataagtccccactt
catacacccgtttctaccattgaaaaagttgatactttcaatttaccattatattcgtct
cctcctataacagagaaaattcatcgcgccaagcagcttccaaagttgccaatttccaca
aatcagaccatttcacattcaatatcatcaactgcccccatcaaatctgtcaaatccagc
aaagaaatggagctgtcattagtatcgttaaaaaatgttagtatagaaaattcgattatg
actcatgacccaaaagaatcaaatattatggctgatttacaacggattaatgaacatatt
tcatcacaagtaccattagaatcaaatatctacaaatccgtggaaagcttatataatgac
aaaatttcgttcccgccaacatgcaattccatgagaggagaaactacaaattctgtcagt
aaaatcgatttaaaagaaacgtatttaagaaatcaatatattttagaatctacagaattg
ctcgacacctgtgtcgctgagcctgaagaagtctccgataatatatctgaatatcggacg
ccttatacattggacatatgtttttcagaagaacaacaatatcattccgatactattact
tctaatatagaaccctattacgttaaaggtggaaaaaattcaaccgaaggtatttttagc
caagctgagcaaattaatgcttgtgtcaattacgaaatttgtgagaatttttcggagaat
cgagtttctacatcaacatacccgagcttaattcaacatgaatcagttcaaccatcaaca
gtctatacctcaattgatgagttttcttctaatagtaacgatgtcaaaattaactcaatc
gtaacatcacaatcgatgcaaatccctataagtcacgacataaatgcaactacgggtttt
aattgcactcagaacgcattcacaaaatctgtttatgtaaataatgcctcagttatggct
gaaactattagccgagatgtttccccttctccttccacactaacgttaacatcaccctca
tcaatggctcctatattatcttacagtgactatatgaaacaatttgaattaccagatttg
ccgcaaccaattattccactaacagccactgtctctattgaacagggtgatacgggacct
atcaacaatattggcatttcaaaaaatgttgataatacacctgattctagcataattgac
gcaacaaccaaatttaaagaaaacttatcaactgaactcattgaagaatttcaaacaacc
agccaagattcgcaaaccaacaattacaaaaaggatccaccgaatagcgcatcacttgta
caaaataccaccattgaatgttcagtagagccgaccactagcactattttcatgaccgac
agtgagcggcctatgtaccatgctttatcattcgacgactcattttatgacagttttaat
gtcgatcttaaaaaactgacggcatctattgcctgtcagcatattgaaactggtttattt
aagaatactcaattaaatgagaattataatacagatttacattttagtgaaactaataaa
cttagtattgagcctagggacttaaatcagaacctccagcatggattaggtgggaattct
ccatcgcagccaaataatccgaaatttttaagtgatcccattcaacaaacgaatatagcc
gtttcttctaaggcatcaagtgtattcggtggactatctaaaggtttaaaaggtggtcta
gatggagtatttaatagtgtcgcttcaactgtagatgccactccacaggtgaacagcaaa
aaagtttttggcttaaacttatcatcaaaattagtccctagtgttggtgagttaatctac
aattccaactcaggcggaaataaacaatcagaaacagaaccaaaattttttacagcaact
gaaatatttttgaacgctaatccaaatatgatggattccaacacatcccccattctttat
gataataaagaccatagatttaatgtaacagaaatgccgattgacattcttcccttagag
gtttataataatgagacaatgtcgacaaattctattttggtagaaaaacagaacgataac
ttcaatgaaagtcacgatgagatgattttgagtgagcaagagattcgtcaaaatcaacaa
gagatagcatatggtacatgtgtaaaacaaaatcaaatagttaatgactatgcaacttct
tttgcacaaaataattatgaatctatatgtacacaacaaaaagttacagacacacctatt
aaagatcatataacgaaaaaaaataacacagcaggtagcatgataggatctattttgggg
aaagcagctgcagctgttcaaacagccacgcaagttgttaatcaaagtgcatcctcggta
gcttcagttatgatacagaaacaatccacaaacacattaactgttgttgaatcgtcaaat
ataattgttcccgcagacttaagagactcaaataaattaaatgacattaatttagaatat
tatgaatattctatgtccaatgaagttactaatcgtaccgatttcacaaatattgggggc
gattatgagaatagtaattttcaattcggtacagatgtagataacaaatcactctcctat
ttgggtaccaatggtaatcagacgcagctagtagttggctcggataccactggaaagaca
aatgagattggaaatggttcgaaaatattacctatggtacctcccgcatccatcagtaaa
aaacttccaataattaatggcaagatgggcttgctcacaaagcaaatgccaaccgagata
tacgatgatgaatttgatttagatgaaatggaagtaaattcaaccggaaaggaaactggg
ttttgcatcgatagtaaacatgatgattactccttgaaacttcagcagaccctctcgcaa
caatcgaacagttattatgaacccattaatagcggttataactacagagaggattacttc
aatgaggaggatgagtataaatatctcgaacagcaagagcagcagaaaaaaatgccaagt
tgtattcagcaggtagatgagactgaaagtgttttattaaataaacaaccatcctcatca
tctgaatacattattgaaggccgagatacagacttaatatatgaaaattatcaaagtgaa
gaagaaagtttaacttatctagatgaaagctcaagtggtagtgttgagcccattgaaagt
aaaaaaagtatacaaatgaatggaggagagcggaaagattccaatggaaaaacgtcgatt
actaatataaatatttcactacaattgccatcgtatcaacatattcaagagaatgaaagt
acttttgataaacccaagttaaatcgcagccaagaacagatttgcatggattcatttgaa
aaatatgaagaactaaatgatcagctttccgatctttctgatttaagaaaaattacgtcg
acgaggaagaaacctcttatacggggtgaaaccgaagaagttgtaggtggacatatgcaa
atgatacgccattctgaagttacagctaaacaacgatggcattgggctttgaataaagtt
atattgcaactaaataatggcattggcgctggagatgttggaatacgaacaaacggacat
cctggcgataaccccttttacagtaatattgacagtatgcctgatatacgacctcgaaga
aaatcaattcctcttgtttctgaactgacgatggccgctacaaaacgaaatgctggactg
acatccgccgttccacgagcaacactcaacgacgaagagttgaaaatgcacgtttataaa
aaagcgctgcaggcgttgatctaccccatttcatcaacaacacctcacaactttttgttg
tggacggctacatcgccaacatattgttacgagtgtgaaggcttactgtggggaatagca
aggcaaggtgtcagatgtactgaatgtggagtgaagtgccatgaaaagtgcaaggatctt
ttaaatgccgactgccttcaacgtgctgctgaaaagagctctaaacacggagctgaggat
aaagctcattcaattataaccgctatgaaggatcgtatgaagcaacgagaacgagaaaaa
cccgaaattttcgaattaattaggatgactttcggtgtggatccagatacacacatagat
tcattagaacaggctgagcacgctactgttgagggaacatctaaatggtcatgcaaacta
acaattacagtgatttgtgctcaaggcctgatagcgaaggataaaagcggtaccagtgat
ccatatgtgacggtgcaggttagcaaagtcaaaaaacgaacgcggacaatgccacaggaa
ctaaaccctgtgtggaatgagaagtttcactttgagtgtcataactcctctgatcgcata
aaagtgcgcgtttgggatgaagacaatgatttaaagtcaaaacttcgacaaaaattgaca
cgagagtcagacgactttttaggacaaacgattatcgaagttcgtacactttctggcgaa
atggatgtatggtataatctggagaagcgaactgataaatctgctgtttctggcgcaata
cgactacatatatcagtggaaataaagggcgaggaaaaggtggctccttatcatgtgcaa
tacacttgcttgcatgagaatctttttcattatctttgtgaagaaaatagtggaatggtt
aaattgccaatccaaaaaggcgatgacgcttggaaactttatttcgatgaaattcctgag
gagattgttgatgagttttcaatgcggtatggaattgaaaacatttatcaagctatgact
cactttcattgcctctcggccaaatacttgtgtcctggagtaccagctgtaatgagcaca
ctattggcaaacattaacgcttattatgcgcatacaacagcatcctctgcagtatctgca
agtgatcggtttgcagctagcaattttgggaaagaaaaatttgttaagttattagatcag
ctacacaactcactcagaattgatttgtcaatgtatagaaataatttccccgcatccagt
tctgaaaaactaatggacttaaagtcgaccgtcgatttattgacaagtataacttttttt
cgcatgaaggttcaggaattgtcgagtccacctagggccagcactgttgtcaaagattgt
gtaaaggcatgtcttcggtcaacttatcaattcctttttgagaattgctacgaactttac
aaccgagagtttcaggtcgatcctaacgaagttaagcgtgccccagatgatcatgaaccc
aaattggacagtgtggacttctggcataaactaatagcactcatcgtgtcagttatagat
gaggacaaaaacagctatggcgcagttttaaatcagtttccccaagaactcaatattgga
caattatcggcatcttcgatgtggcatcttttcgctgtggatatgaaatacgccttagaa
gagcatgaacaacatcgtttatgcaagtcgtcggcttatatgaatctccattttagagtt
aaatggctttatagtaactatgttaaagaagttcctccgtacaagggtgcggtaccggac
tatccagcttggtttgaacctttcgttatgcagtggctaaatgaaaatgatgatgtatca
ttggagtatttgcacggtgcatttaaaagggataaaaaggatgggtttcaaaaaagcagc
gagcacgcactattttcgaattcggtggtcgatgtttttacgcaattgactcaatgtttc
gatgttgttagcaaactcgagtgtcctgatccagaaatttggaaacgttacatgaggcgt
tttgctaaaacaatcgtaaaagttttaatagcttatgctaatattgtaaaaattgagttt
ccagatcatttgaaggatgaaagaatagcatgtatccttatgaacaatattcaacaacta
cgagttcaattggaaaaaatgtttgagtccatgggtggggataagttagaagaagacgca
gctaacattttgaaggaactacaacaaaatttaaattcttctctggatgatttggcttca
caattcgctatcagtttggaacctcgtattacccagtccgtccgtgaactaggggacatg
cttctatctattaagggaggaagcggaaatcttgcagctactaaccaagcaattcaacgc
aatgcggtcgccgttgaagccgatgaagttttaagaccactgatggatttgttggatggc
tcattaacactgtatgcccaaacatgtgaaaaaactgttctaaagaggttacttaaggag
ttgtggaaaattgttatgcgaatattggaaaaaacaatcgttctaccaccaatgactgac
aaaacaatgatgtttaagcacttgactgataatgcaaaaaatttggcatccaatgctaaa
atagaagacatgggtcgactattcaaatctcacatggcaggaaaacaagatgttaaaagt
gcgcttagcggagtaatggacatatctaaggaagtcgaaaaaaatttgtcgcctaaacag
tgtgccgtgctggatgttgccttagatacaataaaacaatatttccacgctggaggaaat
ggattaaaaaagacgtttttagaaaaatcatcggagctacaaagcttgcgttatgcactc
agtctatatacacaaatgacagacactttaatcaaaacatttatatctagccaaactcat
gaggtagatcctgaaaacgcagaagaaagtgttggggaaatttccgtgcaaattgacttg
ttctctcatccaggcacgggagaacacaaagtgaacgtaaaagttgttgcagctaacgat
ctcaaatggcaaataccttcaggaatgttcagaccgtttgtggaaataaatttaatcgga
cctcatctccaagaaaaaaagagaaaatttgcaacaaagtcaaagtcaaataattggtca
ccaaaatataatgagtcattcagctttacaatcggtaatgaggaacagctggacttcttt
gaattacacatttgcgtaaaagactattgctttgctcgtgatgaccgacttgtaggagta
gctgttattccactaaaggacgtttcagaaaagggttctgtcgcatgttggttaccttta
atgagacgtattgaaatggatgaaacaggatggacaattttaaggatattgtcccaacgc
aataatgatgaagtagccaaagaatttgttaagctgaaatcggaaatacgccaggatcca
accatcggctcttaa

DBGET integrated database retrieval system