KEGG   Drosophila ananassae: Dana_GF19085Help
Entry
Dana_GF19085      CDS       T01059                                 

Gene name
Dana_Dsor1
Definition
GF19085 gene product from transcript GF19085-RA
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dan  Drosophila ananassae
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dan00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dana_GF19085 (Dana_Dsor1)
   04068 FoxO signaling pathway
    Dana_GF19085 (Dana_Dsor1)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dana_GF19085 (Dana_Dsor1)
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dana_GF19085 (Dana_Dsor1)
Protein kinases [BR:dan01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dana_GF19085 (Dana_Dsor1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 396 aa AA seqDB search
MSKNKLNLVLPPVNSEATGAATQVAPTPPFKTPSGTDTHSLLGKPKTSIDALTETLEGLD
MDDTERKRIKVFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHL
EVKPAIKKQILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRI
PESILGRITLAVLKGLSYLRDKHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMAN
SFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLESIFADNAEE
GGQPVDEPRAMAIFELLDYIVNEPPPKLEHKIFSNEFKDFVDICLKKQPDERADLKTLLS
HPWIRKAEVEEVDISGWVCKTMDLPPSTPKRNTSPN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacaaactgaacctggtgctgccgccggtgaattcggaggcaactggtgcg
gccacccaagtggctccaactccgccattcaaaaccccctcgggcacagacacacacagt
ttgctgggcaagccgaagacgagcatcgatgcgctgacggagacactggagggcctggac
atggacgacacggaacggaaaaggatcaaagtgttcctcagccagaaggagaagatcggc
gaactctcggacgaggatctggagaagctcggcgagctgggctccggcaacggaggcgtc
gtcatgaaggtccgccacacgcacacacaccttataatggccaggaaactaatccacctg
gaggtgaagccggcgatcaagaaacagatcctgcgcgagctgaaggtcctccacgaatgc
aacttcccgcacatcgttggattctacggagccttctacagtgacggtgaaatcagcatc
tgcatggaatacatggatggtggatccctggatctgatccttaaacgggcgggtcggata
ccggagtcgattctgggcaggataacgctggccgtgttaaagggcttaagctacctgcgc
gacaagcacgccatcatccatcgggacgtgaagccgagcaatattcttgtcaatagcagc
ggcgagataaagatctgtgatttcggcgtttccggccagttgatagactccatggctaac
tcgtttgtgggcacccgcagctacatgtcgccggagcgactgcagggcactcactactcg
gtacagtcagacatctggtcgctgggtctgtcactggtggaaatggccattggcatgtac
ccgatcccgccaccgaacaccgccacattagagtcaatatttgcggacaatgccgaggag
ggtggccagccggtggacgagccccgggccatggccatctttgagcttctggattatatt
gtgaacgaaccgccgccaaagctggagcacaagatattctccaacgagttcaaggacttt
gtggacatttgcttgaagaaacagcccgacgagcgagccgatctcaagaccctgctgagt
catccatggatacgcaaggcggaggtggaggaggtggatatatcgggctgggtgtgcaag
acaatggatctgccgccgtcgacgccaaagcgaaatacgtcgcccaactag

DBGET integrated database retrieval system