KEGG   Drosophila ananassae: Dana_GF19085Help
Entry
Dana_GF19085      CDS       T01059                                 

Gene name
Dana_Dsor1
Definition
(RefSeq) downstream of raf1, isoform A
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dan  Drosophila ananassae
Pathway
dan04013  MAPK signaling pathway - fly
dan04068  FoxO signaling pathway
dan04140  Autophagy - animal
dan04150  mTOR signaling pathway
dan04320  Dorso-ventral axis formation
Module
dan_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:dan00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dana_GF19085 (Dana_Dsor1)
   04068 FoxO signaling pathway
    Dana_GF19085 (Dana_Dsor1)
   04150 mTOR signaling pathway
    Dana_GF19085 (Dana_Dsor1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dana_GF19085 (Dana_Dsor1)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dana_GF19085 (Dana_Dsor1)
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dana_GF19085 (Dana_Dsor1)
Protein kinases [BR:dan01001]
 Serine/threonine kinases: STE group
  STE7 family
   Dana_GF19085 (Dana_Dsor1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Seadorna_VP7 APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 6492918
NCBI-ProteinID: XP_001966804
FlyBase: FBgn0082825
UniProt: B3MZP8
Position
Unknown
AA seq 396 aa AA seqDB search
MSKNKLNLVLPPVNSEATGAATQVAPTPPFKTPSGTDTHSLLGKPKTSIDALTETLEGLD
MDDTERKRIKVFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHL
EVKPAIKKQILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRI
PESILGRITLAVLKGLSYLRDKHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMAN
SFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLESIFADNAEE
GGQPVDEPRAMAIFELLDYIVNEPPPKLEHKIFSNEFKDFVDICLKKQPDERADLKTLLS
HPWIRKAEVEEVDISGWVCKTMDLPPSTPKRNTSPN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacaaactgaacctggtgctgccgccggtgaattcggaggcaactggtgcg
gccacccaagtggctccaactccgccattcaaaaccccctcgggcacagacacacacagt
ttgctgggcaagccgaagacgagcatcgatgcgctgacggagacactggagggcctggac
atggacgacacggaacggaaaaggatcaaagtgttcctcagccagaaggagaagatcggc
gaactctcggacgaggatctggagaagctcggcgagctgggctccggcaacggaggcgtc
gtcatgaaggtccgccacacgcacacacaccttataatggccaggaaactaatccacctg
gaggtgaagccggcgatcaagaaacagatcctgcgcgagctgaaggtcctccacgaatgc
aacttcccgcacatcgttggattctacggagccttctacagtgacggtgaaatcagcatc
tgcatggaatacatggatggtggatccctggatctgatccttaaacgggcgggtcggata
ccggagtcgattctgggcaggataacgctggccgtgttaaagggcttaagctacctgcgc
gacaagcacgccatcatccatcgggacgtgaagccgagcaatattcttgtcaatagcagc
ggcgagataaagatctgtgatttcggcgtttccggccagttgatagactccatggctaac
tcgtttgtgggcacccgcagctacatgtcgccggagcgactgcagggcactcactactcg
gtacagtcagacatctggtcgctgggtctgtcactggtggaaatggccattggcatgtac
ccgatcccgccaccgaacaccgccacattagagtcaatatttgcggacaatgccgaggag
ggtggccagccggtggacgagccccgggccatggccatctttgagcttctggattatatt
gtgaacgaaccgccgccaaagctggagcacaagatattctccaacgagttcaaggacttt
gtggacatttgcttgaagaaacagcccgacgagcgagccgatctcaagaccctgctgagt
catccatggatacgcaaggcggaggtggaggaggtggatatatcgggctgggtgtgcaag
acaatggatctgccgccgtcgacgccaaagcgaaatacgtcgcccaactag

DBGET integrated database retrieval system