KEGG   Drosophila ananassae: Dana_GF19123Help
Entry
Dana_GF19123      CDS       T01059                                 

Definition
GF19123 gene product from transcript GF19123-RA
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dan  Drosophila ananassae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dan00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 276 aa AA seqDB search
MSSRQRTVIIFKSGSETDDVYTETLEKHDFQPVFVPTLSFGFKNLPELRQKLQTPDKYAG
IIFTSPRCVEAVAESLNLGQLPGGWKLLHNYAVGEVTHNLALSSLDQLFTHGKQTGNARA
LGDYIVETFDGSRDLPLLIPCGNLATDTLLSKLAENGFALDACEVYNTLCHPELAENVER
AIATYGDSIEFLAFFSPSGVNCAQEYFRSRNLSMDKWKLVAIGPSTRRALESQGLKVYCT
AERPTVEHLVKVLLNPQDSRERLLKERERLAMENNN
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtcgccagcggacggtgattattttcaaatccggatcggagacggacgatgtg
tacacggaaacgctggagaagcatgacttccagccggtctttgtgcccactctcagtttt
gggttcaagaacctgcccgagctgcgccagaagctccagacgcctgacaagtacgccgga
atcatcttcacatcgccacgctgtgtggaggcggtggccgaatccctgaatctcggccaa
ctgccaggcgggtggaagctgttgcataactacgccgtgggcgaggtgacccacaatctt
gccctcagttccctggaccagctgttcacccacggcaagcagacgggtaacgcccgggcc
ctgggcgactacattgtggaaacgtttgacgggtcgcgggacctgcccctgctcatcccc
tgtggcaacctggccaccgacacgcttctctctaagctagctgaaaatggcttcgctctg
gacgcctgtgaagtctacaacacgctctgccacccagagctggcggagaatgtggagaga
gcgatagctacgtatggggactccattgagttcctagccttcttctcaccgtccggcgtc
aactgcgcccaggaatactttcgcagccggaacctctcgatggacaagtggaagctggtg
gcgatcgggccgagcacacgtcgtgccctggagtcccagggcctgaaggtctactgcacc
gccgagcggcccacagtggagcacctagtgaaggtcctgctgaacccgcaggacagcaga
gagcgcctgctcaaggagcgggaacgactggccatggagaataataactag

DBGET integrated database retrieval system