KEGG   Drosophila ananassae: Dana_GF19123Help
Entry
Dana_GF19123      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dan  Drosophila ananassae
Pathway
dan00860  Porphyrin and chlorophyll metabolism
dan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dana_GF19123
Enzymes [BR:dan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dana_GF19123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-GeneID: 6501886
NCBI-ProteinID: XP_001966733
FlyBase: FBgn0096134
UniProt: B3MZH7
Position
Unknown
AA seq 276 aa AA seqDB search
MSSRQRTVIIFKSGSETDDVYTETLEKHDFQPVFVPTLSFGFKNLPELRQKLQTPDKYAG
IIFTSPRCVEAVAESLNLGQLPGGWKLLHNYAVGEVTHNLALSSLDQLFTHGKQTGNARA
LGDYIVETFDGSRDLPLLIPCGNLATDTLLSKLAENGFALDACEVYNTLCHPELAENVER
AIATYGDSIEFLAFFSPSGVNCAQEYFRSRNLSMDKWKLVAIGPSTRRALESQGLKVYCT
AERPTVEHLVKVLLNPQDSRERLLKERERLAMENNN
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtcgccagcggacggtgattattttcaaatccggatcggagacggacgatgtg
tacacggaaacgctggagaagcatgacttccagccggtctttgtgcccactctcagtttt
gggttcaagaacctgcccgagctgcgccagaagctccagacgcctgacaagtacgccgga
atcatcttcacatcgccacgctgtgtggaggcggtggccgaatccctgaatctcggccaa
ctgccaggcgggtggaagctgttgcataactacgccgtgggcgaggtgacccacaatctt
gccctcagttccctggaccagctgttcacccacggcaagcagacgggtaacgcccgggcc
ctgggcgactacattgtggaaacgtttgacgggtcgcgggacctgcccctgctcatcccc
tgtggcaacctggccaccgacacgcttctctctaagctagctgaaaatggcttcgctctg
gacgcctgtgaagtctacaacacgctctgccacccagagctggcggagaatgtggagaga
gcgatagctacgtatggggactccattgagttcctagccttcttctcaccgtccggcgtc
aactgcgcccaggaatactttcgcagccggaacctctcgatggacaagtggaagctggtg
gcgatcgggccgagcacacgtcgtgccctggagtcccagggcctgaaggtctactgcacc
gccgagcggcccacagtggagcacctagtgaaggtcctgctgaacccgcaggacagcaga
gagcgcctgctcaaggagcgggaacgactggccatggagaataataactag

DBGET integrated database retrieval system