KEGG   Drosophila ananassae: Dana_GF19129Help
Entry
Dana_GF19129      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
dan  Drosophila ananassae
Pathway
dan00511  Other glycan degradation
dan00520  Amino sugar and nucleotide sugar metabolism
dan00531  Glycosaminoglycan degradation
dan00603  Glycosphingolipid biosynthesis - globo and isoglobo series
dan00604  Glycosphingolipid biosynthesis - ganglio series
dan01100  Metabolic pathways
dan04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dana_GF19129
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dana_GF19129
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    Dana_GF19129
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dana_GF19129
   00511 Other glycan degradation
    Dana_GF19129
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dana_GF19129
Enzymes [BR:dan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dana_GF19129
Chaperones and folding catalysts [BR:dan03110]
 Intramolecular chaperones
  Others
   Dana_GF19129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 APG5
Motif
Other DBs
NCBI-GeneID: 6501891
NCBI-ProteinID: XP_001966721
FlyBase: FBgn0096140
UniProt: B3MZG5
Position
Unknown
AA seq 616 aa AA seqDB search
MRSSGYNRYHCYALAICVCFAVGAALTRADDTDHDAQAGSSASRKWLCSQTDICSPETEL
TPGLQYAVERFESQRDCRLSCGKYGSIWPMPTGEAGFIGNERVRFDPWKVRFHVVAPGEA
ATQFLRETNRLFVSNLLKECTRNCTLEGSKQILVRATVANETLVLDWATDESYALVVRTT
DTATFVDIQAPTVYGARHAFETLTNLVTGSLSNGLLMASAARITDRPAFPHRGVLLDTSR
NFVPLKFIRSTLDAMATSKMNVLHWHVVDTHSFPLEITRVPEMQRYGAYSSSQTYSRQDA
LNLVKYARLRGIRILIEIDGPSHAGNGWQWGPAAGLGNMSVCLNQSPWRKFCVQPPCGQL
NPLNDHMYAVLKEIFEDIAEVGAPEETLHMGGDEVFLPCWNNTKEIRDGMRAQGFDLTEE
SFLRLWSQFHQRNLNAWDEITERMYPGIKEPKSVIVWSSHLTDPKYIETYLPKERFIIQT
WVESQDSLNRELLQRGYRLILSTKNAWYLDHGFWGSTSYYNWRAVYSAGMPATQHRSQVL
GGEVCMWSEYVDQNSLESRIWPRAGAAAERLWSNPKSSALAAQRRFYRYRERLLARGIHA
DAVIPHWCVLHEGKCL
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccagcggctacaaccgttatcactgctacgccctcgcgatctgcgtctgcttc
gcggtgggggctgcgctgacgcgggcggacgacaccgaccacgacgcacaagccggcagc
agcgccagcaggaagtggctgtgcagccagacggacatatgctcgccggaaacggagctg
acgcccggactccagtacgccgtggagcggttcgagagccagcgcgactgcaggctgtcc
tgcggcaagtacggctccatctggcccatgcccaccggggaggccggcttcatcggcaac
gagcgcgtgcgctttgacccgtggaaggtgcgcttccatgtagtggctcccggagaggcg
gccacccagttcctgcgcgagacgaatcgcctgttcgtgtccaacctgctaaaggagtgc
acgcgcaactgcaccctggagggaagcaagcagatcctggtgcgggccaccgtcgccaat
gagacgctcgtcttggactgggccaccgacgagagctacgccctggtggtgcggaccacg
gacactgccaccttcgttgatatccaggcgccgaccgtctatggggccaggcacgccttc
gagactctcaccaatctagtcaccggcagcctctccaacggtctcctcatggcatccgcc
gctcgcatcaccgaccggccggcgttccctcaccgcggcgtgctcctggacacgtcccgg
aacttcgtgcccctcaagtttatccgaagcaccctggacgccatggcgaccagcaagatg
aacgtgctccactggcacgtggtggacacacatagcttccctctggagatcacccgggtg
ccggagatgcagcgctacggggcatactcgtcctcgcagacgtacagccggcaggacgcc
cttaacctggtgaagtatgcccgcctgcgcggcattcgcatcctgatcgagatcgacggg
ccctcccacgcgggcaacggctggcagtggggcccggccgccggtctgggcaacatgtcc
gtgtgcctgaaccagtcaccgtggcgcaagttctgtgtccagccgccgtgcgggcagctc
aacccgctcaacgaccacatgtacgcggtgctgaaggagatcttcgaggatattgccgag
gtgggcgcgcccgaagagacgctgcacatgggtggcgatgaggtcttcctgccctgctgg
aacaacaccaaggagatccgggacggaatgcgcgcccagggcttcgacctcaccgaggag
agcttcctgcgattgtggtcccagttccaccagcgcaacctcaacgcctgggacgagatc
accgagcgcatgtacccgggcatcaaggagcccaagtcggtgatcgtctggtccagccac
ctgaccgaccccaagtacattgagacctacctgcccaaggagcggttcatcattcagacc
tgggtggagtcgcaggactccctcaatcgggaattgctccagcggggctaccgcctgatc
ctgtccacgaaaaacgcctggtacctggaccacggcttctggggcagcacctcctactac
aactggcgcgccgtctactccgcgggcatgcccgcgacacagcaccggagccaggttctc
ggcggcgaggtgtgcatgtggagcgaatacgtcgaccagaactccctggaatcccgaatc
tggccacgagcgggagccgccgctgaacgtctgtggtccaatccgaaatcctcggcactt
gcggcccaaaggcgattctatcggtaccgggaacggctcttggcacgaggaatccacgct
gacgccgtcattccccactggtgtgttctacacgagggaaagtgtctctaa

DBGET integrated database retrieval system