KEGG   Drosophila ananassae: Dana_GF19146Help
Entry
Dana_GF19146      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
dan  Drosophila ananassae
Pathway
dan00562  Inositol phosphate metabolism
dan01100  Metabolic pathways
dan04070  Phosphatidylinositol signaling system
dan04933  AGE-RAGE signaling pathway in diabetic complications
Module
dan_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dana_GF19146
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Dana_GF19146
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dana_GF19146
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Dana_GF19146
Membrane trafficking [BR:dan04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    Dana_GF19146
 Endocytosis
  Macropinocytosis
   Phospholipase C
    Dana_GF19146
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y SH2 C2 SH3_1 PH SH3_9 PH_12 SH2_2 EF-hand_like SH3_2 GDPD
Motif
Other DBs
NCBI-GeneID: 6501908
NCBI-ProteinID: XP_001967162
FlyBase: FBgn0096157
UniProt: B3N0S7
Position
Unknown
AA seq 1234 aa AA seqDB search
MSCFSAMNAPLLGEMEQTIGMLERGTIVTKLYGKQRRPDRRRLMLIRETQQLLWATVAAH
SPRSDYEGAIQLREIREIRVGKHSKEFRLFAEECQRFESSKCFVVLHGTNFKLKSFSVVA
LSKIEAENWVRGLRYMVRDTLAAPYPMQIDRWLRREYYQIENVNSQSTKSSDQGPTQVTI
KDFKLFLASVSCKMSTSKFMECFSEDVRRKHDLKFDDFSRLYQKLLQPNNFVNTLCNSNG
VFPYSQDQQTVRQLQLKQFLEIEQRELNSSDLSAASIASFIRDLVQDVERDVQEPHLTVA
EFVDFLFSKQNDIWDKKFNNVFMDMTLPLSNYWIASSHNTYLTGDQFSSESSCEAYARAL
RMGCRCIELDCWNGPDNLPYIFHGHTMTSKIKFMDVIKTIKDHAFTTSEYPVILSIEQNC
SLEQQRNMAQALIEVFGDMLLTQPCDRNEQHLPSPFQLRHKIILKHKKLPQFDDIGNGIG
VTGTLTQRSSLAAGGGGAGEIDGENVRKVFKEGVLYFRDPVDKSWNLYQFVLTHQELIYS
SEINESRNGNSEDDDFGVSLSGTLKNSIQQKQKDTSVNDELHFGENWFHGKLEGGRKEAD
DLLKKYKHLGDGTFLVRESATFVGDYSLSFWRRNRPNHCRIKLKHENGTIKYYLVENFVF
DSLYSLIVYYRKNMLRSSEFSIILKEPVPQPKKHEDQEWFHPNTTKEQAEQALCRLEMGS
FLVRPSVQSANAFVISFTINRKIKHCRILQEGRLYGIDTMNFESLVSLVHYYTRNPLYRN
VKLSHPVSQENLVQVLTEGAQCALVATGDGNVASNYMGPNLDEYVTCKALYSYKASKPDE
LSFPKHAIITNVQRDNSMWWIGDYGGMIKKHLPANYVKVIDCATEDYNSMNEEGTDGRTD
SIEIFGAVASLFESNEPGIIFKLQIQTPTMQNPFVIGFDNQEIAYEWIKAIQEAALVASQ
LATERRKKERTARVAKEMSDLIIYFRSVPFREHSWIFQEMSSFPETKAEKQFFQNNPQLF
LTYHRQQISRVYPKGQRLDSSNFNPMPFWNVGSQMIALNYQTGDKAMQLNQAKFRNNGQC
GYILKPSFMQSDSFNPNNPQCNGLNEIKVCLRLIAARHLFRGGRSNNPQIVVEVVGASFD
SGVKYRTKVNENGFNPVWNETCEFSVRNPHFAILRFEVQDEDMFAETHFIAQACYPLTCL
RQGYRSVVLRNKFSEELELSSLLVHITIESVSST
NT seq 3705 nt NT seq  +upstreamnt  +downstreamnt
atgagttgctttagtgcgatgaacgccccgctgctgggtgagatggagcagaccatagga
atgctggaacggggaactattgtgaccaagttgtacggaaagcaaaggagacctgaccgc
cgccgcctgatgcttattcgtgagacgcagcaattactatgggcaacagtggccgcgcat
tcaccccgctccgactacgagggcgctatccagctgcgtgaaatccgtgagatccgcgtt
ggcaagcactcaaaggaattccgcctatttgctgaagagtgccaacgctttgagagcagc
aagtgctttgtagttctgcacggaaccaactttaagcttaaaagtttttctgtagtagcg
ttgtcgaagattgaggccgagaactgggtacgtggtcttcgctacatggtacgtgacacg
ttggccgcaccgtatcccatgcagatcgaccggtggctgcgacgtgagtactaccagatc
gaaaatgtcaactctcagtcgacaaaatcatcggatcagggtcccacccaggttaccatt
aaggactttaaactgtttttggccagcgttagttgcaaaatgagcaccagcaagtttatg
gaatgctttagcgaagatgttcggcgcaagcatgacttaaaatttgatgatttctctcgt
ctttatcaaaagctcctgcagcccaataactttgtgaacactttgtgcaacagtaatggt
gtatttccgtactcgcaggaccaacagacagtgcgacaattacagttaaaacaattccta
gagatagagcagcgcgaacttaattctagcgatttgagtgccgcatcaattgcttctttt
atacgcgacctagttcaagatgtagaacgggacgtacaggaaccacatcttacagtcgca
gagtttgtggattttctcttttcaaaacaaaatgatatatgggacaaaaagttcaacaat
gtttttatggacatgacacttccgctatctaactactggatagcttcctcccataacacc
tacctaaccggcgaccagttctccagtgagtcttcttgcgaagcatacgcccgggcgcta
cgtatgggttgtcgttgcattgagctggattgctggaacggtccggacaatcttccctat
attttccatggccacacaatgacctcaaaaataaagtttatggacgtaattaaaactatt
aaggaccacgcctttactacctccgagtatccggtgatcctttccattgaacagaattgt
tctctagagcagcaacgcaatatggcacaggcgcttatcgaggtctttggagacatgttg
cttacccaaccatgtgatcggaacgagcagcacttgccttcgccgtttcaattgcgacac
aaaataatactgaagcacaagaaactgccgcagtttgacgacattggaaatggtattggt
gttacggggacgttaacacaaagatcttcccttgccgccggtggtggtggagctggcgag
attgatggcgaaaatgtgcggaaagtgtttaaggaaggcgtactttactttagggacccg
gttgacaagtcgtggaatctttaccagttcgtgctaactcatcaggagcttatttattcc
tctgaaatcaatgaatcgcgcaatggaaactcagaggatgacgattttggcgtatcactt
tccggcaccttaaaaaatagtatacagcagaagcaaaaggacacgtcagtgaatgatgaa
ctacactttggagaaaattggtttcacggaaagctggaaggtggaaggaaagaagctgat
gaccttttaaaaaagtataagcaccttggtgacggaacatttttagtgcgcgagtctgct
acatttgtcggggattatagtttatcgttttggcgtcgaaataggcccaaccactgccgc
ataaagctaaagcacgaaaatggaactatcaagtattacttggtggaaaatttcgtattt
gattcgttatattcgctgattgtgtactaccgaaaaaacatgctgcgcagctcggaattt
tcaatcattctaaaggaaccggtaccacagccaaaaaaacacgaggaccaggagtggttc
caccctaacacaactaaagagcaggccgaacaagcactgtgccggttagagatgggctca
tttctggtgcgaccttcggtgcaaagcgcgaatgcattcgtgatctcgttcacgatcaat
cgaaaaattaaacactgccgcattttacaggaagggcgtttatatggcattgacacgatg
aattttgaatcgctggtgtcgcttgttcactattacacacggaatccgctttaccgtaat
gtaaaactaagtcatcccgtatctcaggaaaatttggtccaagtactgacggagggcgcc
cagtgtgctcttgtggccaccggcgacggcaatgtagcttctaattacatgggccccaac
ctagacgagtatgtcacctgtaaagctttgtatagctacaaggcaagcaaaccagacgaa
ctatcctttccgaagcacgcgattataacgaacgtacagcgagacaattccatgtggtgg
atcggagactacggcggtatgataaagaaacatttacctgcgaactatgtcaaggttatt
gactgtgccacggaagactacaactctatgaatgaggaaggcaccgatggtcgcacggac
tctatcgagatctttggagctgtagcctcacttttcgaatcaaatgagccaggtatcatc
tttaaactgcagatacaaacaccgactatgcagaacccgtttgtgataggttttgacaac
caggagatagcctatgaatggataaaggctatccaagaagcggctcttgtcgccagccaa
ctggctacagagagacgcaaaaaagaacgcacagcccgggtggccaaagagatgtccgac
cttatcatatatttccgtagtgtcccgttccgggaacactcatggatattccaagagatg
tccagcttcccagaaacaaaagcagagaaacagttctttcaaaataacccccagcttttt
cttacctatcaccgtcaacagattagtcgagtgtatccgaaaggccaacgtttggattca
tccaatttcaatcccatgccattttggaacgttggctcgcaaatgatcgcgctgaactac
caaactggtgataaagccatgcaattaaatcaggctaaattccgtaacaacggtcaatgc
ggttatattctgaagccatcgttcatgcaatctgactcttttaatccgaacaatcctcag
tgcaacggactcaatgagatcaaagtttgccttcgactaattgcggcacgccacctattt
cgaggaggcaggtccaacaacccacaaatcgtagtcgaggtagtgggcgcaagtttcgat
tcaggcgttaagtaccgaactaaagttaatgaaaacggctttaaccccgtgtggaacgaa
acctgcgaatttagcgtgcgcaacccacacttcgccatccttcggttcgaggtgcaggat
gaagacatgtttgccgaaacccacttcattgcgcaggcatgctatcctcttacatgtttg
cgccaaggatatcgcagtgtggttctgcgtaacaagttcagcgaggaactagagctgtct
tctctattggtccatataaccattgaaagtgtctcttccacctag

DBGET integrated database retrieval system