KEGG   Drosophila ananassae: Dana_GF19162Help
Entry
Dana_GF19162      CDS       T01059                                 

Definition
GF19162 gene product from transcript GF19162-RA
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dan  Drosophila ananassae
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dana_GF19162
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dana_GF19162
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dana_GF19162
  Exosomal proteins of breast milk
   Dana_GF19162
Heparan sulfate/heparin binding proteins [BR:dan00536]
 Enzymes (General comment) Variety
  Dana_GF19162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 389 aa AA seqDB search
MPGHVSLLLGCLLVLLLGHAPRSAQALHRWSPMMKAFRYLQESMLRNSLERSHLNHGIVF
ECRTISTRDFGNEVHFHLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKDWVQELLLTWTL
FDPNYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPTHFNRSNVTLAGYS
LGAHAAGYAGAVLEGKVEQIIGLDPAGPLFSLPAEVSPKYRLDPGDAQFVQVLHTSGGSL
GTSLKCGHADFYPNGGRAPQTNCKMFANLRDMQNTNPIACSHSAAAIFFRQSMDPEYPFV
GQECASYRQFSAGYCDGNRRARFGIHSQRRAQGSFYFRTAPQQPYVQRRQGLWLDGVARK
AGAGRRADSVLRLWTRSWRRRARDKDRCL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtcacgtgtccctgctcctgggctgcctcctcgtcctgctgctggggcatgcc
ccacgcagcgcccaggccctccaccgctggagccccatgatgaaggccttccgctacctc
caggagtcgatgctacggaatagtctggagaggtctcacctcaatcacggaatcgtcttc
gagtgtcgaaccatctccacgcgggactttggcaacgaggttcacttccacctccagctc
ggcgatctccggggattccgtcgcctggatcccaacaagaagctggccctgtttctgcac
ggctggaacgaccaaggcagcaaggactgggttcaggagctgttactgacctggaccctc
ttcgacccgaactacaacgtctgcgtggtcgactgggggaacctctcccagaacgactac
aagagcgcctccatgtccatcttcgacgtgggactgacggtggccgggatcatcatggcc
ctggaggaactgcgccccacccacttcaacagaagcaacgtgaccctggcgggctacagc
cttggcgcccacgccgcaggatacgccggagcggtcctggagggcaaggtggagcagatc
atcgggcttgatccagcgggacccctgttctcattgcccgccgaggtgtcgcccaagtac
cggttggatccgggggacgcccagttcgtccaggtcctgcacacctcgggtggctccctg
gggacgagcctgaagtgcgggcacgccgacttctatccgaacgggggccgcgcaccgcag
acgaactgcaagatgttcgccaacctccgggacatgcagaacacgaatcccatcgcctgc
agccactctgcggcggccatctttttccggcagtccatggacccggagtacccgttcgtg
ggccaggagtgcgccagctaccgacagttctccgccggatactgcgacgggaaccggcgg
gctcgcttcggcatccattcgcagagacgggcgcaggggagcttctacttccggacggcg
ccccagcagccgtacgtccagaggcgccagggactttggctggacggggtggccaggaag
gcgggcgccggcaggagggccgactctgtcctgcgcctctggaccagatcctggcggcgg
cgggcgagggacaaggatcgctgcctgtag

DBGET integrated database retrieval system