KEGG   Drosophila ananassae: Dana_GF19162Help
Entry
Dana_GF19162      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
Organism
dan  Drosophila ananassae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 389 aa AA seqDB search
MPGHVSLLLGCLLVLLLGHAPRSAQALHRWSPMMKAFRYLQESMLRNSLERSHLNHGIVF
ECRTISTRDFGNEVHFHLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKDWVQELLLTWTL
FDPNYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPTHFNRSNVTLAGYS
LGAHAAGYAGAVLEGKVEQIIGLDPAGPLFSLPAEVSPKYRLDPGDAQFVQVLHTSGGSL
GTSLKCGHADFYPNGGRAPQTNCKMFANLRDMQNTNPIACSHSAAAIFFRQSMDPEYPFV
GQECASYRQFSAGYCDGNRRARFGIHSQRRAQGSFYFRTAPQQPYVQRRQGLWLDGVARK
AGAGRRADSVLRLWTRSWRRRARDKDRCL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtcacgtgtccctgctcctgggctgcctcctcgtcctgctgctggggcatgcc
ccacgcagcgcccaggccctccaccgctggagccccatgatgaaggccttccgctacctc
caggagtcgatgctacggaatagtctggagaggtctcacctcaatcacggaatcgtcttc
gagtgtcgaaccatctccacgcgggactttggcaacgaggttcacttccacctccagctc
ggcgatctccggggattccgtcgcctggatcccaacaagaagctggccctgtttctgcac
ggctggaacgaccaaggcagcaaggactgggttcaggagctgttactgacctggaccctc
ttcgacccgaactacaacgtctgcgtggtcgactgggggaacctctcccagaacgactac
aagagcgcctccatgtccatcttcgacgtgggactgacggtggccgggatcatcatggcc
ctggaggaactgcgccccacccacttcaacagaagcaacgtgaccctggcgggctacagc
cttggcgcccacgccgcaggatacgccggagcggtcctggagggcaaggtggagcagatc
atcgggcttgatccagcgggacccctgttctcattgcccgccgaggtgtcgcccaagtac
cggttggatccgggggacgcccagttcgtccaggtcctgcacacctcgggtggctccctg
gggacgagcctgaagtgcgggcacgccgacttctatccgaacgggggccgcgcaccgcag
acgaactgcaagatgttcgccaacctccgggacatgcagaacacgaatcccatcgcctgc
agccactctgcggcggccatctttttccggcagtccatggacccggagtacccgttcgtg
ggccaggagtgcgccagctaccgacagttctccgccggatactgcgacgggaaccggcgg
gctcgcttcggcatccattcgcagagacgggcgcaggggagcttctacttccggacggcg
ccccagcagccgtacgtccagaggcgccagggactttggctggacggggtggccaggaag
gcgggcgccggcaggagggccgactctgtcctgcgcctctggaccagatcctggcggcgg
cgggcgagggacaaggatcgctgcctgtag

DBGET integrated database retrieval system