KEGG   Drosophila ananassae: Dana_GF19174Help
Entry
Dana_GF19174      CDS       T01059                                 

Definition
GF19174 gene product from transcript GF19174-RA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dan  Drosophila ananassae
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dana_GF19174
  Lipid metabolism
   00062 Fatty acid elongation
    Dana_GF19174
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dana_GF19174
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Dana_GF19174
Lipid biosynthesis proteins [BR:dan01004]
 Fatty acid synthase
  Component type
   Dana_GF19174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 306 aa AA seqDB search
MCRLIIILLLLLILIVGYLWWKPTAGGSNSEVLPVLLWHGMGDTCCLPFSLGAFMELIVA
QTKGTYVRSVEIGGNMVMDWESGFFIHPNEQVDYVCKQLLADEKMAKGYNAIGFSQGGQF
LRAVAQRCPQPPMRTLITFGGQHQGVFGLPSCPTLSVEACAYISRLLTSAAYATAVQEQL
VQATYWHDPLMENNYRRGSTFLADINNELYLNVFYTENLNKLKKFVMVKFLNDTVVQPKD
SQWFEFYTSGQDKVIQPLKDSKVYENLGLNKMQRDGKLVFLGVEGDHLSISKAWFIQNIV
PLLLEK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgactaattattattctgcttctgctcctgattctgattgtgggttacttgtgg
tggaagcccactgcaggtggctccaactcggaggtcctgcctgtgctcctgtggcacgga
atgggcgacacctgctgcttgccctttagccttggtgcctttatggagttaatcgtggcc
cagacgaagggcacctacgtacgctccgtggaaatcggcggaaacatggtcatggactgg
gagagcggcttcttcatccacccaaacgagcaggtggactacgtctgcaagcagctgctg
gcggacgagaagatggccaaaggctacaatgccatcgggttctcgcagggcgggcagttc
cttcgcgcggtggctcagcggtgtccccagcccccgatgcggactctgattaccttcggg
ggccagcaccagggcgtctttgggctgccatcgtgccccaccctgtccgttgaggcctgc
gcctatatatcccggctcctgacctccgcagcctacgcgacggcggtgcaggagcaacta
gtccaggccacttactggcacgacccgctaatggagaacaactatcgccggggaagcacc
ttcttggcagacatcaacaacgagctgtacctaaacgtcttctacacggagaacctgaac
aagctgaagaaatttgtgatggtcaagtttctcaacgacaccgttgtccagccaaaggat
tcgcaatggttcgagttctacacctccgggcaggataaagttatccagcccctgaaggac
agtaaagtctatgaaaacttgggattaaataaaatgcaaagggatggtaaactggtgttt
ctgggcgtcgagggcgaccacttgtccatatccaaggcttggtttattcagaacatagtg
cctctcctactcgaaaagtga

DBGET integrated database retrieval system