KEGG   Drosophila ananassae: Dana_GF19511Help
Entry
Dana_GF19511      CDS       T01059                                 

Definition
GF19511 gene product from transcript GF19511-RA
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dana_GF19511
Peptidases [BR:dan01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Dana_GF19511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 413 aa AA seqDB search
MSEAVPQEPAAPESGVIGPKEGADGSWCLIESDPGVFTELIRGFGCTGAQVEEIWTLDAE
AFHHLEPIHGLIFLFKWVQDDKPIGRVVKDRSDVFFVRQVITNACATQALLCLLMNLQHP
DIDLGETLTSFKSVCQDLDPVVRGLCLSRESKIRSVHNSFARPVLFEVDMRQATVEEDVY
HFVGFMPIKGRLYELDGMQEGPIELAEISKGQNWLDVVRPIIEARMQRYSVGEIHFNLMA
LVSDRQRCYERQIQLLVHQPSPLSHAERQEEIANLRTYVKFEQEKKRRYRQENQRRRHNY
LPFIVELLKQLGETGQLMPIFEKAKKRAMECHLQATLKQQQLQQELQQQQQLLLDQEEQE
RQEPQDSDCLNKEKSPKLNLTWHNDAPGQEAAPPDGDAGDAVIPNPNTNTRSG
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagctgttccacaagaaccagctgcaccagaatccggcgtcatcggccccaag
gaaggagccgatggcagctggtgtctcatagagagcgaccccggcgtcttcaccgagctg
atccgaggctttggctgcactggtgctcaggttgaggagatttggacattggatgctgaa
gccttccatcatttggagcccattcatggtctcatctttctgttcaagtgggtgcaggat
gacaagcccataggccgtgttgtcaaagatcgtagcgatgtttttttcgtacgccaggtt
atcaccaatgcctgtgccacccaggcgctcctctgcctcttgatgaatctccagcacccg
gacatcgatctgggcgagactctgacgtcgttcaagtccgtttgccaggatctcgatccg
gtggtgcgtggcctgtgcctcagccgcgaatcgaagatccgttccgtgcacaactcgttc
gcccgtccggtgctctttgaggttgacatgcgccaggccacggtcgaggaggatgtgtat
cacttcgtgggcttcatgcccatcaaagggcgtctgtacgagctggacggaatgcaggag
gggcccatcgagctggccgagatcagcaagggtcagaactggctggacgttgtccgtccg
atcattgaggcgcgcatgcagcgctacagtgtgggagagatccacttcaatttgatggcc
ctggtgtccgatcgccagcgctgctatgagcgccagatccagctgctggtccaccagccg
tcgccgttgagccatgccgagaggcaggaggagatcgccaatctgcgaacctacgtcaag
ttcgagcaggagaagaaacgtcgctaccgacaggagaaccagcgtcgtcgccacaactac
ttgccgttcattgtcgagctactgaagcagctgggcgagaccggccagctgatgcccatc
ttcgagaaggccaagaagcgggccatggagtgccacttgcaggccactctcaagcaacag
cagctccagcaagagctccaacagcagcagcaactgctactggatcaggaggagcaagag
cgccaggagccccaggattccgactgtctcaataaggagaagtcgcccaaactcaactta
acgtggcacaacgatgctcccggacaggaggctgctcccccggacggagatgccggagat
gcggttataccgaatccgaatacgaatacaaggtccggatga

  All links  
No link information was found.   
DBGET integrated database retrieval system