KEGG   Drosophila ananassae: Dana_GF19514Help
Entry
Dana_GF19514      CDS       T01059                                 

Definition
GF19514 gene product from transcript GF19514-RA
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
dan  Drosophila ananassae
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dan04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1144 aa AA seqDB search
MEIETDQSIEAMDTQDTQEVEIITSDLQQQQQQQQQQQQQQQQQQQQNSPPQLPKFKNLI
QPPLHAVGAVTQLPSENGNVPPQQLLADSSSASFGNNDSEAMPMDDETKEDQFRSETTFS
FTVENVGQLKSQRLSPPVYVRMLPWKIMVIPNDRALGFFLQCNGENDSPTWSCNAIAELR
LKCHKPDAQPFTRAKIKHLFYSKENDYGYSNFITWQELQDPEKTYVHNNSITLEVHVIAD
APHGVLWDSKKHTGYVGLKNQGATCYMNSLLQTLYFTNSLRLAVYRIPTEADDSTKSVGL
SLQRVFHELQFGDRPVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTCLEG
TIPGLFEGKMSSYIKCKNVDYNSTRYETFYDIQLNIKDKKNIYDSFQDYVASETLEGDNK
YDAGVHGLQEASKGVIFTSFPPVLHLHLMRFQYDPITDSSIKYNDRFEFYEQINLDRYLA
EGEKTSADYVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQEAIEQNYG
GMDDEISFHAKCSNAYMLVYIRQSELDRVLGEIQESEISSDLVERLDLEKRIEMARRKER
SEANLYVSVHVILEEYFEGQQKRRLFDLEKTHQRPFKLKQNQTVEELVDMFVKGFGVARD
RMRIWNMCTAQTQKFLHFDFEAEASRTIEQIPTSQKPWVIFLELASPENPAPLPPFNPKT
DVLLFLKYYDARNKRLNYIGCTQQPQSRRLIDLVPEVNRKLGFEPDTELTVFDEYADKKI
PNLCEPIESVLYIPQDHLQGHILIFERENVDDKLDLPTVEDYFMDLVYRIEIIFSDKCNP
NEPDFTLELSNRYNYEQLTNAVAERLNTDPQKLQFFMCINNYKETAGNAVPYTFKGTVKD
LVSYTKQSTPKRIFYQRLSLSIHELDNKKQFKCVWVSPDLKEEKELVLYPNKNDTVKGLL
EEAAKKITFAENSRRKLRLMKVSNHKIMSVCKDDIPLDTLLKTSESITTTQGAQKTYRIE
EVPADEMQLTENELLVPVAHFSKELYNSFGVPFLTKARHGEPYGALKQRIQKRLNVPDKE
WENYKFSVITMGTNSDVNDNTPVDLEVYRSWTSGQLPFFGLDHINKSRKRSSLNFSEKAI
KIYN
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atggaaatagaaacagaccagtcgatcgaagcaatggatacccaggacactcaagaggtc
gagattatcaccagtgacctccaacaacagcagcaacaacaacaacagcaacagcagcag
caacaacaacaacaacaacagaattctccgccacaattgccgaaatttaaaaatcttata
cagccgccactacacgctgtgggcgccgtcacccaactgcccagcgagaacgggaacgtg
ccgccccaacagctcctagcggacagtagttccgcctcattcggtaataacgattcggag
gccatgccaatggacgatgagacgaaggaggaccagttccggtccgaaacaacattctca
ttcaccgtcgagaatgtcgggcagctgaagtcgcagcgattgtcgccaccagtctatgtc
cggatgctgccatggaagattatggtgataccgaacgatcgggcattgggattctttctg
cagtgcaatggagagaatgattcgcccacctggtcgtgcaatgcgatcgccgaactccgt
ctaaaatgccataagccggacgcccaacccttcacccgggccaagatcaagcatctgttc
tactcgaaggagaacgattacggctattcgaacttcatcacatggcaggagctgcaggat
ccggagaagacctatgtccacaacaatagtattacattggaggtgcatgtgattgccgat
gcaccgcatggcgttctatgggactcaaagaagcataccggctatgtgggactcaagaat
cagggggccacctgctatatgaactccctgctccagaccctatactttaccaattcattg
agattggccgtctatcgcatccccacggaggccgatgacagcaccaagtcggtgggccta
tcccttcagcgggtattccatgaacttcagttcggtgatcggcccgtcggcaccaagaag
ctaaccaagtcatttggatgggagacactcgattcgtttatgcagcacgatgtacaggag
ttcctgcgcgtcctcctcgacaagctggagtcgaagatgaaggggacgtgtctggagggg
accataccgggactcttcgagggcaagatgtcgtcgtacatcaagtgcaagaacgtggac
tacaatagcacccgctacgagaccttctacgacatccagctgaacatcaaggacaagaag
aacatatacgattccttccaggactatgtggcctccgagacgctcgagggcgacaacaag
tacgatgcgggtgtccatggtcttcaggaggccagcaagggcgtcatcttcacgtcattc
ccgcccgtgctgcacctgcatctgatgcgattccagtacgatcccatcaccgacagctcg
atcaagtacaacgatcgcttcgagttctacgagcagatcaacctggaccgctacctggct
gagggcgagaagacctcagcggactatgtcctccatgccgtgctggtgcactccggtgac
aaccatggcggtcactatgtcgtcttcatcaatccgaaggccgacggacgttggttcaag
ttcgatgacgatgtggtgtccagttgccggaaacaggaggccatcgaacagaactacggc
ggcatggatgatgagatctcgttccatgccaagtgcagcaatgcctacatgctggtctac
atccggcagtcggagctggatcgggtgctgggcgagatccaggagagcgagatttccagt
gatctggtggagcggctggatctggagaagcggatcgaaatggcccgccggaaggagcgc
agcgaggccaatctgtatgtgtcggtgcatgtcatcctggaggagtactttgagggacag
cagaagcgccgactattcgatctggagaagacccaccagcgccccttcaagctcaagcag
aaccagaccgtggaggagctggtggatatgtttgtcaagggattcggggtggcgcgggat
aggatgcgcatatggaacatgtgcaccgcccagacccaaaagttcctgcactttgacttc
gaagcggaggcctcgcgcaccatcgaacagatacccacatcccagaagccgtgggtcatc
ttcctggagctggcctcgcccgagaatcccgcccccctgccaccgttcaatcccaagacc
gatgtcctgctcttcctcaagtactacgatgcgcggaacaagcgtctcaactacatcggt
tgcacccagcagccgcagagccggcggctcatcgacctggtcccggaggtgaatcgcaag
ctgggcttcgagccggacaccgagctgacagtcttcgatgagtatgccgacaagaagatc
cccaatctctgcgagccgatcgagagcgtgctgtacataccgcaggatcatctgcagggc
cacatccttatctttgaacgggagaacgtcgacgacaagctggacctgcccaccgtggag
gactacttcatggacctggtctaccgcatcgagatcatcttcagcgacaagtgcaacccc
aacgagccggactttacgctggagctctccaatcgctacaactacgagcagctgaccaat
gccgtcgccgagcgcctcaacaccgatccccagaagctccagttcttcatgtgcatcaac
aactacaaggagacggcgggcaatgcagttccatacacctttaagggcaccgtcaaggac
ttggtgtcctacaccaaacagagcactcccaagcgcatcttctaccagcgcctatccctc
agcatccacgagctggacaacaagaagcagttcaagtgcgtctgggtcagtcccgatctc
aaggaggagaaggaactggtcctctatcccaataagaatgacaccgtcaagggtctgctg
gaggaggcggccaagaagatcacgttcgcggagaacagtcgccggaagctgcgcctcatg
aaggtcagcaaccacaagatcatgtccgtgtgcaaggatgacataccgctggacacgcta
ctgaagaccagtgagtcgataacgacgacgcagggcgcccaaaagacgtatcgcatcgag
gaggtgccggcggacgagatgcagctgacggagaacgagctcctggtgccggtggcccat
ttcagcaaggagctgtacaattcgttcggtgttccattcctgaccaaggcccgtcacggt
gagccgtacggcgccctgaagcagcgcatccagaagcgtctgaacgttccggacaaggag
tgggagaactacaagttctccgtcatcaccatggggactaactcggatgtgaacgataat
acgccggtggatctggaggtgtatcgctcctggaccagcggacagttgccgttctttgga
ctggatcacatcaacaagtcgcgcaagcgcagctcccttaacttttccgagaaggccatc
aagatatacaactaa

DBGET integrated database retrieval system