KEGG   Drosophila ananassae: Dana_GF20215Help
Entry
Dana_GF20215      CDS       T01059                                 

Definition
GF20215 gene product from transcript GF20215-RA
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
dan  Drosophila ananassae
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dana_GF20215
   03008 Ribosome biogenesis in eukaryotes
    Dana_GF20215
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     Dana_GF20215
Ribosome biogenesis [BR:dan03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     Dana_GF20215
Transfer RNA biogenesis [BR:dan03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    Dana_GF20215
Mitochondrial biogenesis [BR:dan03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    Dana_GF20215
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 168 aa AA seqDB search
MESNAPKEHGAKPRSNNRRNNNNRHRVVRKQPPRPASGRQHIYITRKTDFKAQLRRCQEL
FSSGAKEIFLHCMGFSVTRGVNLALRLIENSEGTLSYAINTSTISLLDELHPLCDEEDLT
FRHRKNSALHIKIFNRSLFEIAVPPLPAAPTPQLQAQSQFRGKAKPRQ
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaatgctccaaaggaacacggggccaagccgagatccaacaacagacgcaac
aacaacaacagacaccgagtagtgcgaaagcagccaccacgtcctgccagcggccgccag
cacatttatattaccagaaaaacagacttcaaggctcagctgcggcgatgccaggagctg
ttcagctctggcgctaaggagatcttcctgcactgcatgggcttctccgtcacacgcggc
gtcaatcttgccctgcgtctcatcgaaaactcggagggaacccttagctacgcaatcaac
acctccaccatcagcttgttggacgaattgcacccattgtgtgatgaggaggacctgacc
tttcgccaccgcaagaactcggcattgcacatcaagatcttcaatcgcagcttgtttgag
atagcggtgccaccgttgcccgctgcaccaaccccgcagcttcaagcgcagtcccagttc
cgaggaaaagcaaagcccaggcagtag

DBGET integrated database retrieval system