KEGG   Drosophila ananassae: Dana_GF20220Help
Entry
Dana_GF20220      CDS       T01059                                 

Definition
GF20220 gene product from transcript GF20220-RA
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
dan  Drosophila ananassae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dana_GF20220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2073 aa AA seqDB search
MDGVTEDMWTPYKHLYSVFQQAVSNPTGVTSELELCLKKFKQNFTNFLRNPPKNEKSRSQ
LRNAANEGITLPGQTRKVHLSQDLIDEALIVSDMFDLDEVFAVELLCTAQRQQLHHPGLP
RGLVAVLLYYDGRKAISCALRDMFQAVSGVSWSTELPREITYLVTNYAQNLVEDTNILGR
LLELLDEMDLDKECLLLTKNRAFGSKKHQNQVLGIYEDIQRALAMALFHWSAQRGLPRPI
IIRLMQLLASRKTIDASGNPDDVTTIMLMALLYGYDTSVLLVTESNNLHTARLPIFSDPD
YAKAFLDALYAQSTWEIPRLDAVIKYSFGLTLASLRHAPSHLQAAALASISRDEILINEA
LAANVFGFFYRQLLEKDVIYSTEFIYRRMHLLITDFIDYMHGKVSELRGRADEAARMVVS
FTNEGLEPPPNIDSNFELLMLCVAKLYGDPRVTLRLCDEYWGPCDPTGTGFGVLASTSTP
NSSRSVSLFKFISLASELLPQTLFKSYLKMITGLTRTEFAARCAFNLLKNCQAVTSSYTV
SWDHFFSALANYYNNMRNDFNTNISAAGDTIYRSRTLPRVMTQRETEHMVAVMGIVRAVA
EYDEISRLMICEQVSWQPTQVLLGLVACSTPLVLKAEILFTLSALAKSRETARAIWMNLE
DSQIIATVPVSSSFGQCSLAEEIEQNESRLEQYQLTRGLLQLLYNLMTSNMPRNLGMGCR
KPGYDAYLNFVVETILLKFYNRAYKDPAEKWKVGAQCLKLLYFLLATYRPRSTDFQEARD
EHPYPGYHVMLQLQLKSEVLRLLLRIIEEARERLDDYNRFHGKEMLEECSLYALLLLEAG
LSKQNAFFEAHSAGNSPILLSGLNRMLLDLNPRSRRPDHVLNIVKYVTYNSWLPRHALAA
VKILSAVTQLPQVSAQILSMYASGSNEKLEIRQGFVECLEMDARVAQQNDELLEQLALND
HVPFLGFGEDYDRERERNKDREDSIESRMSLSRMCQPEDDATLLQSRPASIELQLKEAIV
KLFSMNLSQPLPNFVYFLLGVDVLRDFMANDKQHLGIEMHCSCVNSLVLLLEKYLEKQRH
SEEYCEHTAHVVERIYHLFHGLCANRRTSETVLRYFRLTCNDFLLRHLTALPFRQHNQDD
VLHTMAHLLNCVAIEIKLAATHGQTTRYSLMCDILLLGSGADGQRPPHGVPIEISAPSYF
AMDLMPGGAIIGTGTAPAAAQATGAANQKPPGIILQDSAMGLHANRLLDVLVLESASISQ
PQMEFFDIQLMECLLRDCEGTPTPGADNTPAKLINIRKLHDILLDELRIVQSTIVSGQRK
AIMTEIMELLQHAVRINRVRKQRCATLAFMEAWCLMIQVLFSSMPEAVLSVSLRRQHIID
VIEKMLLKVDPIQPIIEVSIQVSETVLLLLANLRFCCYQVEDQRYDDVTNDPLSLVTNGN
ANGGDSQATKLGLSRSSGYAGGGAINGADPTASVSNLRFILKRLVEWIMVSEVKSQKLRI
NLYSALLNCLRIAKRLRTDEQKEYNERPSSMSLRMDPSKGGAHIDQRYDDRQRLKEMASD
VIGTFGEKLIDTICHDAVTGHDVCRMLALACLDMISELHAVSTLSDFVAMRGYLKHLLDS
LAKSSEALCGILQPVPDNLRPLYVYESRMAFLTRMAHTSLGARLVLGDRALGVLSNMRVF
DLQPDLKASELRRNDPQTFLPAIDARFRAILLPALNLCDAIINSLGPRNKSASMQVLNFL
FAHVDMVEAMLRTATPIMDLGHLQQLAAMTNLFARTTTHEVATVEDTLDVENDLELRQRL
GRLQQLMIVVFGRFCVSEATIRRMVQQEHHEASESTKSLHVKYFLDIAANLSLYCRNAVT
SHIRDSNTSKYLLTTMIQDVTPLTGKTDGKKLTAIMHTILNQLKGAVGYYLSQKSLADNL
LQQRASLPNLTFGPNGKQSFLELSQRHNEKRSELMQAVFIAEQNLYLLWIHLDFYLRNAV
VYANENRNSINESNLDGGNMSVLNASHDEIVSLKQMLISTFNETFCTQLITASETYAPKC
SGFNSSLLRRIKALVQFAPVNGSFGGDPQTSIM
NT seq 6222 nt NT seq  +upstreamnt  +downstreamnt
atggatggtgtaaccgaggacatgtggacgccgtacaagcatctctacagcgttttccag
caggccgtctcgaaccccaccggcgtcacctccgagctggagctctgcctcaaaaagttc
aaacagaacttcacaaactttctgcgcaatccgcccaagaatgagaagagccgaagccag
ctgcgaaacgccgccaacgaaggcatcacactgcctggccagacgcgcaaggtgcatctg
tcgcaggacctcatcgacgaggccctcatcgtgtcggacatgttcgacctggacgaggtc
ttcgcggtggagctgctctgcaccgcccagcggcagcagttgcaccatcccggcttgccc
agaggcctggtggccgtcctcctctactatgatgggcgcaaggccatcagttgtgcgctg
cgggacatgttccaggcggtgagcggcgtgtcctggagcacggagctgcccagagagatt
acctatttggtcacaaactatgcccagaatctggtggaagatacgaatattctgggtcgc
ttgctggagttgctggacgagatggatttggacaaggagtgcttgctgctgaccaagaac
cgcgccttcggctccaagaagcaccagaaccaggtcctgggcatctacgaggacattcag
cgggccctggccatggccctgttccactggtcggcccagcgcggcctgccgcgtcccatc
atcatccgtctgatgcagctcttggcctcacggaagaccatcgatgcatccggcaacccg
gacgacgtcacgacgatcatgctcatggccctgctgtacggctatgacacctccgtgctg
ctggtcaccgagtccaacaatctgcacactgcgcgcctgcccattttcagtgacccggac
tatgcgaaggccttcctggacgccctctacgcacagagcacctgggagattccgcgcctg
gacgcggtcatcaagtacagcttcggcctgacgctggccagcctgcggcacgcccccagc
cacttgcaggcggccgccctcgcctccatcagtcgggatgagatcctaatcaacgaggcc
ctggccgccaacgtgtttggcttcttttaccgccagctgctggagaaggatgtgatctac
tccacggaattcatctaccggcgcatgcacctcctgatcacggacttcatcgactacatg
cacggcaaggtgtcggagctgcggggcagggcggacgaggccgcgcggatggtggtcagc
ttcacgaacgagggcctggagccgccgcccaacatagactccaacttcgagctgctgatg
ctgtgcgtggccaagctgtacggcgacccgcgggtgaccctccgcctctgcgacgagtac
tgggggccctgcgacccgactggaaccggattcggtgtcctggcgtcgacctccacgccc
aactcgtcgcgctccgtctccctcttcaagttcatcagcctggccagcgagctgctgccc
cagacgctcttcaagtcctacctgaagatgatcaccggcctgacccgcaccgagttcgcc
gcccgctgcgccttcaatctcctgaagaactgccaggcggtgacctcttcctacacggtc
agctgggaccacttcttctccgccctggccaactactacaacaacatgcggaacgacttc
aacacgaacatcagtgccgccggggacaccatctaccggagccgcactctgccccgggtg
atgacccagcgcgagacggagcacatggtggccgtgatgggcattgtgcgggcggtggcc
gagtacgacgagatctccaggctgatgatctgtgagcaggtgtcctggcagcccacccag
gtgctgctcggcctggtggcctgctccactcccctggtgctcaaggcggagatcctgttc
actttgtcggcgctggccaagtcccgggagacggcccgcgccatctggatgaacctggag
gactcgcagatcatagccaccgtgccggtgtccagctccttcggccagtgcagcctggcg
gaggagatcgagcagaacgagagccgcctggagcagtaccagctgacgcggggcctcctg
caactcctctacaacctgatgaccagcaacatgccccgcaacctgggcatgggctgccgg
aagcccggctacgacgcatatctgaactttgtggtggagacaatcctgctgaagttctac
aaccgggcctacaaggacccggccgagaagtggaaggtgggcgcccagtgcctcaagctg
ctctacttcctgctggccacatatcgcccccgctccaccgactttcaggaggcccgcgac
gagcacccgtacccgggctaccacgtcatgctgcaactgcagctgaagtcggaggtgctg
cgcctgctcctgcgcatcattgaggaggcgcgcgagcgcctggatgactacaaccgcttc
cacggcaaggagatgctggaggagtgctccctgtacgccctgctgctcctcgaggcgggc
ctgtccaagcagaacgccttcttcgaggcccactcggccggcaactcgcccatcctactc
tccggcctgaaccggatgctgctcgacctgaatccgcgcagccgccggcccgaccacgtc
ctcaacatcgtcaagtacgtcacctacaacagctggctgccgcggcacgccctggcggcc
gtcaagatcctgtcggcggtcacccagctgccgcaggtcagcgcccagatcctcagcatg
tacgcgagtggcagcaacgagaagctggagatccgccagggcttcgtcgagtgcctggag
atggacgcgcgtgtggcccagcagaacgacgagctgctggagcagctggccctcaacgac
catgtgccgttcctgggcttcggcgaggactacgaccgggagcgggagcggaacaaggac
cgcgaggattccattgagagtcggatgtcgttgagcaggatgtgccagccggaggacgac
gccaccctgctgcagtcgcgccccgccagcatcgagctgcagctgaaggaggccatcgtg
aagctgttctccatgaatctcagccagccgctgcccaacttcgtgtacttcctgctcggc
gtggacgtcctgcgcgacttcatggccaacgacaagcagcacctgggcatcgagatgcac
tgttcgtgcgtgaactcgctggtcctgctcctggagaagtacctggagaaacaacgccac
agcgaggagtactgcgagcacacggcccacgtggtggagcgcatctaccacctgttccac
gggctgtgcgccaaccgcaggacctcggagacggtgctccgctacttccggctgacctgc
aacgacttcctgctgcgccacctcacggccctgcccttccgccagcacaaccaggacgac
gtcctgcacaccatggcccacctgctgaactgcgtcgccatcgagatcaagctggcggcc
acccacggtcagaccacgcgctacagcctcatgtgcgacatcctgctcctgggctcgggc
gccgacggccagcgtccgccccacggcgtgcccatcgagatatcggcgcccagctacttc
gccatggacttgatgccgggcggcgccataatcggcaccggaaccgccccagccgccgcc
caggccaccggcgccgccaaccagaagccgccgggcatcatcctgcaggactcggccatg
ggcctccatgccaaccggctgctcgacgtcctcgtcctcgaatcggcctccattagccag
ccccagatggagttcttcgacatccagctgatggagtgcctgctgcgggactgcgagggc
acacccacgcccggggcggacaacacgcccgccaagctgatcaacatccggaagctgcac
gacatcctgctggacgagctgcgcatcgtccagagcaccatcgtcagtgggcagcgcaag
gcgattatgaccgagatcatggagctgctgcagcacgccgtccggatcaaccgcgtccgg
aagcagcgctgcgccaccctggccttcatggaggcctggtgcctgatgatccaggtcctg
ttcagcagcatgcccgaggcggtgctctccgtctctctgcgccgccagcacatcatcgac
gtcatcgagaagatgctgctgaaggtggaccccatccagccgatcatcgaggtgagcatc
caggtgagcgagacggtgctcctgctgctggccaacctgcgcttctgctgctaccaggtg
gaggaccagcgctacgacgacgtcaccaacgatcccctctccctagtcacgaatgggaat
gccaacggcggcgactcgcaggccaccaagctgggcctgtcccggtccagcggctatgcc
ggcggcggcgccatcaacggcgccgatcccaccgccagcgtcagcaacctgcgcttcatc
ctcaagcggctcgtggagtggatcatggtcagcgaggtgaagtcccagaagctgcgcatc
aacctctacagcgccctgctcaactgcctgcggatcgcgaagcgcctgcgcaccgacgag
cagaaggagtacaacgagagaccctcgagcatgtcgctccgcatggacccctccaagggc
ggcgcccacatcgaccagcgctacgacgaccgccagcggctcaaggagatggccagcgac
gtgatcggcacctttggcgagaagctgatagacaccatctgccatgatgccgtgaccgga
cacgacgtctgccgcatgctggccctggcctgcctggacatgatctccgagctgcacgcc
gtgtccacgctgagcgactttgtggccatgcggggctacctgaagcacctgctggacagc
ctggccaagtcgagcgaggcgctgtgcgggatcctgcagccggtgcccgataacctgcgc
ccgctctacgtctacgagtcccggatggcgttcctcacccgcatggcccacaccagcctg
ggcgcccgcctcgtcctcggcgaccgggcgctgggagtgctctccaatatgcgggtcttc
gacctccagccggacctcaaggccagcgagctgcgccgcaacgatccccagaccttcctg
ccggccatcgacgcccgcttccgggccatcctcctgccggccctcaacctctgcgacgcg
atcatcaactcgctggggccgcgcaacaagtccgcctccatgcaggtgctgaacttcctg
ttcgcccacgtggacatggtggaggcgatgctgcgcacggccaccccgatcatggacctg
ggccacctgcagcagctggcggccatgacgaacctgttcgcccgcaccaccacccacgag
gtggccaccgtggaggacaccctggacgtggagaacgacctggagctgcgccagcgcctg
ggccgtctgcagcagctgatgatcgtggtgttcggccggttctgcgtcagcgaggccacc
attcgccggatggtgcagcaggagcaccacgaggcctccgagagcaccaagagcctgcac
gtcaagtacttcctggacattgccgccaacctgtcgctctactgccgcaacgcggtcacc
agccacatccgggacagcaacacctccaagtacctgctgaccaccatgatccaggacgtg
acgccactaactggaaagacggacggcaagaagctcacggccatcatgcacacgatcctg
aaccagctgaagggagccgtgggctactacctctcgcagaagtccttggcggacaatctg
ctccagcaacgggcctccctgcccaacctgacctttggtcccaacggcaaacagagcttc
ctggagctgagccagcggcacaatgagaagcgttccgagctgatgcaggccgtgttcatc
gcggagcagaacctgtacctgctgtggatccacctggacttctacctgcgcaacgccgtg
gtctacgccaacgagaaccgcaactccatcaacgagagcaacctggacggcggcaacatg
tccgtgctgaacgcctcccacgacgagatcgtctccctgaaacagatgctcatctccacc
ttcaacgagaccttctgcacccagctgatcaccgccagcgagacctacgctcccaagtgc
agtggcttcaactcctcgctgctgcgccgcatcaaggccctcgtccagttcgcccccgtc
aacggctccttcggcggggatccgcagacctccatcatgtag

DBGET integrated database retrieval system