KEGG   Drosophila ananassae: Dana_GF20313Help
Entry
Dana_GF20313      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dan  Drosophila ananassae
Pathway
dan00010  Glycolysis / Gluconeogenesis
dan00562  Inositol phosphate metabolism
dan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dana_GF20313
   00562 Inositol phosphate metabolism
    Dana_GF20313
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     Dana_GF20313
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     Dana_GF20313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 6503024
NCBI-ProteinID: XP_014761285
FlyBase: FBgn0097320
UniProt: A0A0P8YKL3
Position
Unknown
AA seq 475 aa AA seqDB search
MLKPLYYLFWFSLPSLALPGLFFFLLAGGAAGGDVGVAAGQEAVECSRLERADIEGRLST
KTPYRAIANFNETSPQYAGCRPTRIWSIIRHGTRNPSEKVILLAQSRLAEIKEDILNQSN
PNLCAGELKKLRKWSWNFLNAAEDEKLLVAEGEDELTELAERMQNRFPSLLPDIYDPGWY
FFKYTATQRTLKSAHSFATGLFGRHRIHAVRYPPPMHQDPILRFYKRCGRWKTDVDKNPD
TLVNARRFLAEPQMQSAVEHVRSSTRLPELRPEDVQLMYTVCAFETAWRRPRHGDRWPTH
SVWCNFFDVPALNAMEFFEDLEYYWNDGYGYELTHRIACPAIADMFAAISSSDDTEEQGP
LRSNATFYFTHSGTLLKLLAHLGLARDEEPLTHRHFASERLWRTSQIDAFATNLAFLRYD
CDEDEPHVLVLHQERVVRLPGCPLDKDLCPLATLRRIYADSVERCDFEELCQLKD
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagccgctctactatttgttttggttttcccttccgtctttggcgctccccggg
ctcttcttctttctgctcgctggaggggctgccggtggtgatgtgggcgtggcagcgggc
caggaggcggtagaatgtagtcgtttggagcgagccgatatcgagggaagactctctacg
aagacaccgtaccgagcgatcgccaatttcaatgaaacttcgccacaatatgccggatgc
cgtccaacgcgaatctggtcgatcatccgccacggcacccgcaatcccagcgagaaggta
atcctcctggcccagagccgcctcgccgagatcaaggaggacatcctgaaccaatctaat
ccgaatctctgtgccggggaactgaagaaactgcgcaagtggagctggaatttcctgaac
gccgccgaggacgagaagttgctggtggccgagggcgaggacgagctgaccgaactggcg
gagcgcatgcagaaccgtttcccatccctcttgccggacatctacgaccctggctggtac
ttcttcaagtatacggccacccagaggaccctgaagagcgcccacagcttcgccacaggg
ctttttggacgccatcggatccatgctgtgcggtatcctcctcccatgcatcaggatccc
attctaaggttctataagcgctgcggaagatggaaaactgacgtcgataagaatcccgat
accttggtcaacgcacgcaggttcctcgcggaaccgcagatgcagtcagcagtggagcat
gtgcggagcagcacccggctaccggaactccggccggaggatgtccagctcatgtatacg
gtgtgcgccttcgagacggcatggcgccggccgcgccacggtgatcgatggcccacccac
tcggtgtggtgcaacttctttgatgtgcccgccctgaatgccatggagttcttcgaggac
ctggagtactattggaacgatggatacggctatgaactaacccatcgcattgcctgtccg
gcaatagcggatatgtttgcagccataagttcctcggatgatactgaggagcaaggaccg
ctccggtccaatgccacattctacttcacgcactcgggaacgctgctgaagctgctggcc
cacctcggactggcccgggatgaggagccgctgacgcacaggcattttgccagcgagagg
ctctggcgcaccagccagatagacgccttcgcgaccaatctggccttcctgcgctacgat
tgcgatgaggatgagccgcatgtcctggtattgcaccaggagagagtggtacgcctgccc
ggctgtccactggacaaggacctctgtccgctggccacgctgcgtcgcatctacgccgac
agcgtggagcgctgcgacttcgaggagctgtgccagctaaaggactaa

DBGET integrated database retrieval system