KEGG   Drosophila ananassae: Dana_GF20313Help
Entry
Dana_GF20313      CDS       T01059                                 

Definition
GF20313 gene product from transcript GF20313-RA
Orthology
K07204  
regulatory associated protein of mTOR
Organism
dan  Drosophila ananassae
Pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dan04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2062 aa AA seqDB search
MLKPLYYLFWFSLPSLALPGLFFFLLAGGAAGGDVGVAAGQEAVECSRLERADIEGRLST
KTPYRAIANFNETSPQYAGCRPTRIWSIIRHGTRNPSEKVILLAQSRLAEIKEDILNQSN
PNLCAGELKKLRKWSWNFLNAAEDEKLLVAEGEDELTELAERMQNRFPSLLPDIYDPGWY
FFKYTATQRTLKSAHSFATGLFGRHRIHAVRYPPPMHQDPILRPVYLFASPGKPEKTLAR
ASPVAVPVPVQSSPAGTLRFRFRFREIQPINMLESHYSAMLNAAASVAAAAASAAAAAAA
SASASASASADDNSNNSNNSNTTSNTNSQSQSSNTNSNNSSSNGSAVDIAGAEAATGTEG
DDDSQDGANWSRKKMIKWPLPMTLSFFPATDLSGRFVFGERIRDEKCPLSFLAKRHSEAI
VAMVYERQTWRIRERMKTASVALVLCLNIGVDPPDVVKIQPCSRLECWIDPSSVSPPKAM
ELIGSSLQMQYERWQPRARYKKCHDPTVEDVKKLCTSLRRNAKGERILFHYNGHGVPKPT
ANGEIWVFNKTFTQYIPLSIFELITWMSAPSIYVYDCSNAGIIINSFQPYAEQHELELEK
QRATLQKRGGVPQLAGTGGAPGTAGGQNQQMQQQVSYKNCIHLAACAANEILPMNAQLPA
DLFTSCLTTPINIALKWYAMQEKLGMVPPIQSELIDKIPGKVNDRRTMMGELNWIFTAIT
DTIAWNTLPRELFQRLFRQDLLVASLFRNFLLAERILRSHDCTPVSLPALPPCFRHPMWK
AWDLVVDLALQQLPDILEHNAPYRQLPFFEHQLTAFQVWLDSESESRTPPEQLPIVLQVL
LSQVHRLRALELLARFLDLGPWAVNLALGVGIFPYVLKLLQSSTRELRPVLVFIWAKILA
VDPSCQVDLVKEYKYFLSVLQDTTVSKEHRTLSAFVLASIVHNFLLGQTSALQGPLLSIC
LEQLNDGSWLLRQWLAICLGMLWQNFEKARWSGARDLAHEKLYVLLRDSIPEVRAAAVFA
LGTFISSVTDRSEEQANNIDRIIAVTLLETVGEDMSPLVRMELAAALQWMVLLFESQFVA
IYQVEHVRDNASAFFVRDVLERHVSMRRGASSSSISNMGGGTSTSSGGGSASGAGGGSLS
GSTSGRSKSGSGGSSGAGAAAGGTNTIPYQMIFTKLWQGICNLAQDPFPRVAAIAHEIVE
HVRDTALCPIMAAKEATMATATEKCNSLSVSLPPSPNTRVNYLSGAAGGGGAGGGAGESP
PVGATASGASHWAQKLRLSGSGAGVAAGDPHAILQRKLRTSSINDETDSAPAAYPGRPGW
GGSLGLPSGPRESTHSARSSGSESNQYLEPPQSLTPIVQTEFIPWAISYFTRPGKHRYSS
AEGAAEEGFQRFPVDRNSAELRKRSSRYMRNDFVRRQARRHQREQSDRSGYEMCVWNRKT
QFTPSIVKLLPYEPQIAVAYREKVLAYDFQWNSVRTYGSEAMAGTPHGSSSVFSRVSSVE
FINAQDEALKLVAHDDGVVRVWQSSPGAHSSSSSSTSSSASSSSSTADDPPAKARLVTAW
TALSPVHQQQNSYRQRIIGSGGGSIGKGMDASSLSSMSSGIVTAWQQAQQHLVVGGGGCR
YLRLWDVERELRLSDIPLGRSEAGAARVLAPYLPNMRCDVILAGCDDGSVRLFDKRCAPQ
ESRICVYRRHDAPILHASLRANETVLVSGCTDGRINVVDVRATSFPYGIEERVIHKWNAG
SDVTAIASHQIADTVACGNAFKISIHSLDGRLQKTLRTNEGFIGPKTGHPTCLSFHPYKV
QLAVGFVDNTFYKRCGRWKTDVDKNPDTLVNARRFLAEPQMQSAVEHVRSSTRLPELRPE
DVQLMYTVCAFETAWRRPRHGDRWPTHSVWCNFFDVPALNAMEFFEDLEYYWNDGYGYEL
THRIACPAIADMFAAISSSDDTEEQGPLRSNATFYFTHSGTLLKLLAHLGLARDEEPLTH
RHFASERLWRTSQIDAFATNLAFLRYDCDEDEPHVLVLHQERVVRLPGCPLDKDLCPLAT
LRRIYADSVERCDFEELCQLKD
NT seq 6189 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagccgctctactatttgttttggttttcccttccgtctttggcgctccccggg
ctcttcttctttctgctcgctggaggggctgccggtggtgatgtgggcgtggcagcgggc
caggaggcggtagaatgtagtcgtttggagcgagccgatatcgagggaagactctctacg
aagacaccgtaccgagcgatcgccaatttcaatgaaacttcgccacaatatgccggatgc
cgtccaacgcgaatctggtcgatcatccgccacggcacccgcaatcccagcgagaaggta
atcctcctggcccagagccgcctcgccgagatcaaggaggacatcctgaaccaatctaat
ccgaatctctgtgccggggaactgaagaaactgcgcaagtggagctggaatttcctgaac
gccgccgaggacgagaagttgctggtggccgagggcgaggacgagctgaccgaactggcg
gagcgcatgcagaaccgtttcccatccctcttgccggacatctacgaccctggctggtac
ttcttcaagtatacggccacccagaggaccctgaagagcgcccacagcttcgccacaggg
ctttttggacgccatcggatccatgctgtgcggtatcctcctcccatgcatcaggatccc
attctaaggcctgtatacctgtttgcgagtccaggtaaacccgagaagacactcgctcgt
gcctcgccagtggcagtaccagtaccagtgcagtccagtccagctggtactctcagattc
cgattcagattccgggaaatccagccaataaacatgctcgaatcccattatagcgccatg
ctcaacgctgccgcctcggttgcagcggctgcggccagtgctgctgctgctgccgccgcc
tcagcctccgcatccgcatccgcctccgccgacgacaatagcaacaacagcaacaatagc
aacaccaccagcaacaccaacagccagagccagagcagcaacaccaacagcaacaacagc
agcagcaacggcagtgccgtggacatagccggagctgaagcggccaccggaaccgaggga
gacgacgacagccaggatggtgccaactggagccgcaagaagatgatcaaatggccattg
ccgatgacgctgtccttcttcccagccacggatctgagcggaagattcgtgttcggggag
cggatccgggatgagaagtgccctctctccttcctggccaagcgccactcggaggcgatc
gtggcgatggtgtacgagcgccagacctggcgcatccgggagcgcatgaagacggccagt
gtggcgctggtcctctgcctgaacatcggcgtggatccgccggacgtcgtcaagatacag
ccgtgctcccgccttgagtgctggatcgatcccagttcggtgtcgccgccaaaggccatg
gagctgattgggagcagcctgcagatgcagtacgaacggtggcagccgcgggcgcgctac
aagaagtgccacgatcccaccgtggaggacgtgaaaaagctgtgcacgtcgctgcgccgc
aacgccaagggcgagcgcatcctgttccactacaacggccacggcgtgcccaagccgacg
gccaacggggagatctgggtcttcaacaagaccttcacccagtacataccgcttagcatc
ttcgagctgatcacctggatgtcggcgccgtctatctacgtctacgactgctccaatgcc
gggatcattatcaactccttccagccctatgccgagcagcacgagctcgagctggagaag
caacgggccaccctccagaagaggggcggcgtaccgcagctggcaggcactggtggtgct
ccgggtacggccggtggacagaaccaacagatgcagcaacaggtcagctacaagaactgc
atccatctggccgcctgtgccgccaacgagatcctgccgatgaacgcccagctgccggcc
gatctcttcaccagctgcctgaccacgcccatcaacatagccctcaagtggtacgccatg
caggagaagctgggcatggtgccgcccatccagagcgagctgatcgacaagataccaggc
aaggtcaacgatcgccggaccatgatgggcgagctcaactggatcttcacggccatcacg
gacacgatagcctggaacacgctgccgcgtgagctgttccagcgcctgttccgccaggac
ctgctagtagccagtctgttccggaacttcctgctggcggagcgcattctgcgcagccac
gactgtacgcccgtatccttgcccgctctcccgccctgtttccgccatccgatgtggaag
gcgtgggacctggtggtcgacctggcgctgcagcagctgcccgacatcctcgagcacaat
gccccctaccggcagctgccgttcttcgagcaccagctgaccgcgttccaggtgtggctg
gacagcgagtccgagtcccggacaccgcccgaacagctaccgatcgtcctgcaggtcctc
ctctcccaggtgcaccggctgcgggccctggagctcctggcccggttcctagatctgggc
ccgtgggccgtcaatctcgccctgggcgtgggcatcttcccgtatgtgctgaagctgctg
cagagctccacccgcgaactgcgacccgtgctggtgttcatctgggccaagatcctggcc
gtggatccctcctgccaggtggacctggtcaaggagtacaagtacttcctgtccgtcctg
caggacaccaccgtctcaaaggagcaccgcaccctctccgccttcgtgctggcctccatc
gtgcacaacttcctgctcggccagacgagcgccctgcagggtcccctgctctccatctgt
ctggagcagctgaacgacggcagctggctgctccgccagtggctggccatctgcctgggc
atgctgtggcagaacttcgagaaggcgcgctggtccggtgcccgcgacctggcccacgag
aagctatacgtcctgctaagggactccattccggaggtcagggccgctgccgtcttcgcc
ctgggcaccttcatcagctccgtgacggatcgcagcgaggagcaggcgaacaacatcgat
cgcatcatcgccgtcaccctgctggagaccgtgggcgaggacatgtcgccactggtacgc
atggagctggcggccgccctccagtggatggtgctgctcttcgagtcccagttcgtggcc
atctaccaggtggagcatgtgcgggataacgcctccgccttcttcgttcgtgatgttctg
gagcggcacgtgagcatgcgccgcggcgccagttccagttccatatcgaacatgggtggc
ggtacctccacctcgagcggcgggggatcggccagtggcgccgggggcggcagcctgtcc
ggcagcacgtcgggccgttcgaagagcggctcgggcggcagctcgggagccggagcagct
gccggcggcaccaacaccataccatatcaaatgatcttcaccaagctgtggcagggcatc
tgcaatctcgcccaggacccgttcccgcgggtggcggccatcgcccacgagatcgtggag
catgtccgggacaccgccctgtgccccatcatggccgccaaggaggccaccatggccacg
gccacggagaagtgcaacagcctgagcgtcagcctgccgccgagtcccaacaccagggtg
aactacctgagcggcgcggccggcggagggggagctggaggcggggccggcgaatccccg
cccgtgggagccaccgcctcgggcgccagccactgggcccagaagctgcgactgtccggg
agcggagccggtgtggccgccggtgatccgcacgccatactgcagcggaagctgcgcacc
agctccatcaacgacgagactgacagcgccccggcggcgtatccgggacggccggggtgg
ggcgggtcgctgggactgccgagcgggccgcgggagagcacccactcggcgcggagcagc
ggcagcgagagcaaccagtacctggagccgccccagagcctgacgcccatcgtccagacg
gagttcataccgtgggccatctcctacttcacccggccggggaagcatcgctacagcagc
gccgagggagcagcggaggagggattccagcggttccccgtcgaccggaactcggcggaa
ctgaggaagcggagctcgcggtacatgcggaacgactttgtgcggcggcaggcgcgacgc
catcagcgggagcagagcgatcggtccggttatgagatgtgcgtgtggaaccggaagacc
cagttcacgccctccatcgtcaagctgctgccgtacgagccccagatcgcggtggcctac
cgggagaaggtgctggcctacgacttccagtggaactcggtgcgaacgtacggctcggag
gcgatggccggcacgccgcacggctcctcctcggtcttctcgcgggtcagcagcgtggag
ttcatcaacgcccaggacgaggcgctcaagctggtggcccacgacgatggagtggtgcgc
gtctggcagtcctcgcccggcgcccactcctcctcgtcctcctccacctcctcgtcggcg
tcgtcctcctcctcgacggccgacgatccgccggccaaggcgcgcttggtcaccgcctgg
actgccctcagtccggtccaccagcagcagaacagctaccggcagcgcatcatcggctcc
ggcggcggcagcatcggcaagggcatggatgccagcagcctcagttctatgtccagcggc
atcgtgaccgcctggcagcaggcgcagcagcacctggtggtgggcggcggcggctgtcgg
tatctgcggctgtgggacgtggagcgggagctgcggctgagcgacatcccgctgggccgg
agcgaggcgggtgccgcccgcgtcctggcgccctacctgcccaacatgcgatgcgacgtg
atcctggccggctgtgacgacggctctgtgcggctgttcgacaagcggtgtgccccgcag
gagtcccggatctgtgtctatcggaggcacgacgcccccatcctgcacgccagcctgcgg
gccaacgagacggtgctggtgtccggatgcaccgacggccggatcaatgtggtcgatgtg
cgggccacctcgttcccctacggcatcgaggagcgtgtcatacacaagtggaatgccggc
agcgatgtgacggcgatcgccagccaccagatcgcggacacggtggcgtgcgggaatgcc
tttaagatcagcatccattcgctggacggccggctgcagaagacgctgcgcaccaacgag
ggcttcatcgggcccaagaccggccatcccacctgcctctcgttccatccgtacaaggtg
cagctggcggtgggcttcgtggacaacacattctataagcgctgcggaagatggaaaact
gacgtcgataagaatcccgataccttggtcaacgcacgcaggttcctcgcggaaccgcag
atgcagtcagcagtggagcatgtgcggagcagcacccggctaccggaactccggccggag
gatgtccagctcatgtatacggtgtgcgccttcgagacggcatggcgccggccgcgccac
ggtgatcgatggcccacccactcggtgtggtgcaacttctttgatgtgcccgccctgaat
gccatggagttcttcgaggacctggagtactattggaacgatggatacggctatgaacta
acccatcgcattgcctgtccggcaatagcggatatgtttgcagccataagttcctcggat
gatactgaggagcaaggaccgctccggtccaatgccacattctacttcacgcactcggga
acgctgctgaagctgctggcccacctcggactggcccgggatgaggagccgctgacgcac
aggcattttgccagcgagaggctctggcgcaccagccagatagacgccttcgcgaccaat
ctggccttcctgcgctacgattgcgatgaggatgagccgcatgtcctggtattgcaccag
gagagagtggtacgcctgcccggctgtccactggacaaggacctctgtccgctggccacg
ctgcgtcgcatctacgccgacagcgtggagcgctgcgacttcgaggagctgtgccagcta
aaggactaa

DBGET integrated database retrieval system