KEGG   Drosophila ananassae: Dana_GF20363Help
Entry
Dana_GF20363      CDS       T01059                                 

Definition
GF20363 gene product from transcript GF20363-RA
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
dan  Drosophila ananassae
Pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dan00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    Dana_GF20363
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 907 aa AA seqDB search
MVVSTLHITLENNGSGSPGAPPTGVDHPTPVANLAPNSPQSTPAKCVTRHPLQYPQNEKE
NHQNNNNSDYCDMNGNGLGMGIGIGMGMGIMGVAVAGSPASSIASSTATPQRSASALRRG
IQIQRSSTRLRQQQEQLRRRREEEERIAQQNEFLRNSLRGSRKLKALQDTTATPGKAVAQ
QQAHQQQQQSMPQAVGVENEAYLPDEDQQAPQEQIDGYGELIAALTRLQSQLSKSGLSTL
AGRVSAAHNVLASASVAHVLAARTAVLQRRRPRVAGPLHHSALGLQKDIVELLTQSNTAA
AIELGNLLTSHEMEGLLLAHDRIANHTDGTPSPTSTGTPTSAMTPTPGQQPPAATTTLSG
HSSPVTSAKRNLGMVVAPPVVPPPLAQRGAMPLPRGESPPPPPPLPVSGNPLAMPMSACF
GTLNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGRIVRGGAAEKSGLLHEGDEILEVN
GQELRGKTVNEVCALLGAMQGTLTFLIVPAGSPPPGGGLVGGPQSGLGTGPGAHRDTAVL
HVRAHFDYDPEDDLYIPCRELGISFQKGDVLHVISREDPNWWQAYREGEEDQTLAGLIPS
QSFQHQRETMKLAIAEEAGLARSRGKDGSGSKGATLLCARKGRKKKKKASSEAGYPLYAT
TAPDETDPEEILTYEEVALYYPRATHKRPIVLIGPPNIGRHELRQRLMADSERFSAAVPL
FYLLEERLKPAKSKAQVKDTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKA
YYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQKKLRNGE
PFKEEELKDIIATARDMEARWGHLFDMIIINNDTERAYHQLLAEINSLEREPQWVPAQWV
HNNRDES
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atggtggtatccacactacacataacactggagaacaacggatcggggagccctggtgca
ccacccaccggggtggatcatccgactccggttgccaacctcgccccgaacagcccacag
tcgacacccgctaagtgcgtcactcgccatccgctacagtatccacagaacgaaaaggag
aaccatcagaacaataacaatagcgactattgtgacatgaatggcaatggcttgggtatg
ggtatcggtatcggtatgggtatgggtataatgggcgtggctgtggcgggatcacccgcc
tcctctatcgcctcttcgactgccacgccccaacgcagtgcctccgccttgcgacgcggc
attcagatccaaagatcctcgactcggttgcgacaacaacaggagcaacttcgaaggcga
cgcgaagaggaggagcggattgcccagcagaatgagttcctgcggaacagtctgcgcggc
tccaggaagctcaaggctctccaggacaccactgccacgcccggcaaggcggtggcgcag
cagcaggcccaccaacaacagcaacagtccatgccccaggcggtgggcgtggagaacgag
gcgtacctgccggatgaggatcagcaggcgccccaggagcagatagatggctatggagaa
ctgatcgccgccctgacacgcctccagagccagctgagcaagagcggcctgagcaccctg
gcgggcagggtgtccgccgcccacaatgtcctggccagcgccagtgtggcccatgtcctg
gccgccaggacggccgtgctgcagcgccgcagaccccgcgtcgcaggacctctgcaccac
agcgccctcggcctgcagaaggacatcgtggagctgctgacgcaatcgaatacggcggct
gccatcgagctgggcaacctgctgaccagccacgagatggagggactcctcctggcccac
gatcgcatcgccaatcatacggacggcacaccctcgcccacatccacgggcacgcccacc
tcggcgatgacgcccacgccgggacaacagccgccggcggcgacgacgacgctgagcggt
cacagcagtccggtaaccagtgcgaaacgtaacttgggcatggtggtggcgccgccagtg
gtgccgccgccgttggcgcaacgcggcgccatgcccctgccacgcggggagtcgcctccg
ccgccgccaccgctaccggtgtccggcaatccgctggccatgccgatgagtgcttgtttc
gggacgctgaacgaccagaacgacaacatccggatcatccagatcgagaagtcgacggag
ccgctgggcgccaccgtgcggaacgagggcgaggcggtggtcattggccggatagtgcgg
ggcggagcggccgagaagtccggcctcctgcacgagggcgacgagatcctggaggtcaat
ggtcaggagctgcgcggcaagacggtgaacgaggtgtgcgccctgctgggtgccatgcag
ggcaccctcaccttcctcatcgtgccggccggtagtccaccgcccggcggcggcctggtc
ggtggcccgcagtccggacttggcaccggaccgggcgcccatcgggacactgccgtgctg
catgttcgcgcccatttcgattacgatccggaggatgatctgtatataccctgccgggag
ctgggcatcagcttccagaagggcgatgtcctgcacgtgatcagccgggaggatccgaac
tggtggcaggcgtatcgcgagggcgaggaggaccagacgctggccggtctcattcctagt
cagtcgttccagcaccagcgggagaccatgaagctggccattgccgaggaggcgggtctg
gcgaggtcccgcggcaaggacggatcgggcagcaaaggagccaccctgctctgtgcccgc
aagggacgcaaaaagaagaagaaggccagctcagaagcgggttatcctttgtacgctacc
acggcaccggatgaaacggatccggaggagatactcacctacgaggaggtggccttatac
tatccccgtgccacccacaagcggcccatcgtcctcatcggcccgcccaacatcggccgc
cacgagctccgccagcggctgatggccgactcggagaggttctccgccgccgtgccactc
ttctacttgctggaggagcgtctgaagccagccaagtccaaggctcaggtcaaggacaca
tccagggctcgcagagagggcgaggtgcccggcgtggactaccatttcatcaccaggcag
gctttcgaggcggacatcctggcgcgacggttcgtggagcacggcgagtacgagaaggcc
tactacggcacctccttggaggccatacgcactgtggtggccagcggcaagatctgtgtc
ctgaatctgcatccccagagcctcaagctgctgcgtgcctccgacctgaagccctatgtc
gtcctggtggcgccacccagcctggacaagctgcgtcagaagaaactgcgcaacggcgaa
cctttcaaggaagaagagctcaaagacatcattgccacggccagggacatggaggccaga
tggggccatctgttcgacatgataatcatcaacaatgacacggagcgcgcctaccaccaa
ctgctggcggagatcaactcgctggagcgtgagccgcagtgggtgccggcacagtgggtg
cacaacaaccgggacgagtcataa

DBGET integrated database retrieval system