KEGG   Drosophila ananassae: Dana_GF20363Help
Entry
Dana_GF20363      CDS       T01059                                 

Definition
(RefSeq) GF20363 gene product from transcript GF20363-RB
  KO
K06091  
MAGUK p55 subfamily member 5
Organism
dan  Drosophila ananassae
Pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dan00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    Dana_GF20363
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1988 aa AA seqDB search
MQANSSRSNLSAQSSGTPSTSTISSSQGKQQVVELSGYVIILVENVEGKIKLYGSPPDRD
NLEVGDEILEVNGLTLDNISRTEVIRHIHDCIKSCTICLRVRKKNDTRLAWDIGNSVQDA
FVIAVEEHARERLQRLAALNRVTPVDITQLSKKLQQTKSGTVTSQRQDLSFLNESTPIYV
TSFTSNQITCSSSTMTTATAGGPISAPSLALAPTTATGTVPSAAAAAAAAAAAVQGASAL
VSAAVAAATAADRNANSTTSAALKSGGGAGGAASGSAAAGSTSATGQIYQTSQAQQQQLQ
QLQQQLAAAAAAGKPLQAKSLLASSLQHLAEEVDNEDLDDDDDVDGANYCGITYINYNNK
HAQLPTTTLPATTALPAAAATLATTAAIHQQRQKQSSLHRPGVPAPLQLGGPPNPSFVDA
QTSTSPLLAAMEPKIEPQTQQRHVHGTTTPKTEYSTAISSGQLKQAFAELQLHSSNNNAS
LQQQQQQQHLLLSNNNNSNNSTAAAQTASLMKNCDLLISNNLYSQRRELLEDVIVHQASD
VHAYNSSATAIASGSSGSNVRSQQQQQQQQQQQQLLSANYELQQQLQLQQQQQQQLQQPN
SPTSSISIGRTELLLGDQSLRPDARGNRRRSGSSIVVLDGDDLKPCLPDDYISGQHHLNL
QQQQQQQLQQQQQQQLQQQLQQQHPQQLQQHYRTHSSDIRGEIDQEMLTMLSVNQDNGPH
REMAVDCPDTFIARNKTPPRYPPPRPPQKYKKSTNTNTNTNTKNNATKITALTNNDHANK
LLIVAYHSSHQHEQQQQQQQSSSQQQQQQLKHQHSCKTTNKIALDVATQNLYNQKQQNKL
EQIENYENCLQSEQQQQQQLVASGGGGATQQVAQQQTPSHKLQSTLSNDPNGNTNSSSKT
NSNNSSITEDYLDGLYHQHHNHHQHSPTSSNFDEVLSKHTLDSFGSIAYRHLNQQQTTSN
GNSNTSNSNTSNSNSNTSNSNSNTDSNKLNPNTKTVTNSNSNSNSLNSSNSSMHTSNTSN
SSSSGHSSNMVSSSSTSSSTVPDDLSLAPPGYEVSQKLEEQQQQHVAPVVLLPPIAKHRE
LPVDVPDSFIEMVKTPPRYPPPAHLSSRGSLLSNASGSTAHTTLSSLGVVSVAATTTTTP
TTTGAAATSQVATAIGDELNGNAKPVPPPRDHLRVEKDGRLVNCSPAPQLPDRRAPGNAS
SGSGSGSGGLIAPQQIAQIVEPTMEQLDSIKKYQEQLRRRREEEERIAQQNEFLRNSLRG
SRKLKALQDTTATPGKAVAQQQAHQQQQQSMPQAVGVENEAYLPDEDQQAPQEQIDGYGE
LIAALTRLQSQLSKSGLSTLAGRVSAAHNVLASASVAHVLAARTAVLQRRRPRVAGPLHH
SALGLQKDIVELLTQSNTAAAIELGNLLTSHEMEGLLLAHDRIANHTDGTPSPTSTGTPT
SAMTPTPGQQPPAATTTLSGHSSPVTSAKRNLGMVVAPPVVPPPLAQRGAMPLPRGESPP
PPPPLPVSGNPLAMPMSACFGTLNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGRIVR
GGAAEKSGLLHEGDEILEVNGQELRGKTVNEVCALLGAMQGTLTFLIVPAGSPPPGGGLV
GGPQSGLGTGPGAHRDTAVLHVRAHFDYDPEDDLYIPCRELGISFQKGDVLHVISREDPN
WWQAYREGEEDQTLAGLIPSQSFQHQRETMKLAIAEEAGLARSRGKDGSGSKGATLLCAR
KGRKKKKKASSEAGYPLYATTAPDETDPEEILTYEEVALYYPRATHKRPIVLIGPPNIGR
HELRQRLMADSERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEK
AYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQKKLRNG
EPFKEEELKDIIATARDMEARWGHLFDMIIINNDTERAYHQLLAEINSLEREPQWVPAQW
VHNNRDES
NT seq 5967 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgaacagcagccgctccaacttaagcgcacaatcctcgggcacgccgtcgacc
tcaacgatctcctcgtcgcagggcaagcaacaagtagtcgaactatctggctatgtcatc
atactcgtcgagaatgtggagggcaaaattaaactatacggctcaccgcccgatcgcgat
aatctggaagtgggcgatgagatactcgaggtcaatggcctgaccctggacaatatatcc
cgtacggaggttattcgtcacatccacgactgcatcaaatcctgtaccatttgtctgcga
gttcgaaagaagaatgatactagattggcctgggacattggcaactcggtgcaggacgcc
ttcgtcatcgccgtcgaggagcacgcccgggagcgtctgcagcggttggcggccttgaac
cgggtcacccccgttgacatcacccagctgtccaagaagctgcaacagacgaagagtggc
acggtgaccagccagcggcaggacctgagcttcctcaacgagtccactcccatctatgtg
acgtccttcaccagcaaccagatcacctgcagcagctccaccatgacgacagcgaccgcc
ggcgggccgataagcgccccctccctggccctggcccccaccacggccaccgggacagtg
ccgtcggcggcggcggcagcggcagcagcagcggcggcggtccagggtgcctcggcgctg
gtgagtgccgctgtggcagctgccacggcagcggatcggaatgccaacagcacgacatct
gcggccctgaagagtggcggaggagcgggcggcgccgcgagtggcagcgcggcagcgggc
agcaccagtgccacggggcagatataccagaccagccaggcgcaacagcagcagttgcag
caactgcagcagcaactggcggcagcggccgctgctgggaagccgctgcaggccaagtcc
ttgctggccagcagcctgcagcacctcgccgaggaggtggacaacgaggacctggacgac
gacgatgatgtggatggggccaactactgtggcatcacctacatcaactacaacaacaag
cacgcccagttgccgacaacaacgctgccggccaccacagccctgccggcggcagctgcc
acattggcaacaacggccgccatccatcagcagaggcagaagcagtcgtcgttgcatcgt
ccgggggtgccggcacccttgcaactcggcggcccaccaaatcccagctttgtggatgcc
cagacctccacctcgccgctcctggcggcgatggagccgaaaatcgagccgcaaacgcaa
caaaggcatgtccatggcaccaccacacccaaaacggagtactccacggccatatccagt
ggtcagctgaagcaggcgttcgccgagctgcagctccactccagcaacaataatgcatcc
ttgcaacagcagcagcaacaacaacacctacttttaagcaacaacaataatagcaataat
tccacggcagctgcccagacggcgtctctcatgaagaattgtgatctactgatatccaat
aatctatattcgcaaaggagagagttactagaagatgtcatagtccatcaggccagtgat
gtgcatgcctacaactcgagtgcaacagcaattgccagtggcagcagtggcagcaacgtt
agatcccagcagcagcagcagcagcagcagcagcagcaacaactgctgagtgccaactac
gagttgcaacaacaattgcaactgcaacagcaacaacagcagcagctgcagcaaccaaac
agtcccacaagtagcatatcaataggaagaactgaacttttattgggcgatcagagtttg
cggccagacgcaagagggaatcgccggcgttccggctctagcattgttgtgctggacggc
gatgacctgaagccatgcctcccggatgactacataagcggccagcatcacctcaacctg
cagcaacagcaacagcaacagctccagcaacaacagcagcaacagctgcagcagcaactg
caacagcaacacccccaacagttgcagcaacactatcgcacccactcgagcgacatccgg
ggagagatagatcaggaaatgctgaccatgctgtccgtgaaccaagataacggtcctcac
cgtgaaatggccgttgattgtccggacacgttcatagcccgtaacaagacaccgcccaga
tatccgccaccccgtccaccacagaaatacaagaaaagcaccaataccaacaccaacacc
aacaccaagaacaatgcaacaaaaatcactgctttgactaacaatgatcatgctaacaaa
ttgttaattgttgcatatcattcttcacatcaacatgaacaacaacaacaacaacaacaa
tcatcatcacaacaacaacaacaacaattaaaacaccaacattcatgcaaaacaacaaac
aaaattgcactcgatgttgcaacacaaaatctatacaatcaaaaacaacaaaataaattg
gaacaaatcgaaaactatgaaaattgtctacaatcggaacaacagcaacagcaacagcta
gttgctagtggtggtggtggtgcaacacaacaagtggcacaacagcaaacaccaagccac
aagttgcaatcaacactaagcaatgatcccaatggcaatacaaactccagcagcaaaacc
aacagcaacaacagcagcattacggaggactatctggatggattgtatcatcagcatcat
aaccatcatcagcactcacccacatcgagcaatttcgatgaggtcctgagcaaacacacc
ctagactcctttggcagcatcgcctatcgtcacctgaaccagcaacagacgacgagcaat
ggcaacagcaacaccagcaacagcaatactagcaacagcaacagcaacactagcaacagc
aacagcaacactgacagcaataaacttaatccaaataccaaaacagtgaccaacagcaac
agcaacagcaactcactgaacagcagcaacagctccatgcacaccagcaacactagcaac
agcagcagcagcggacacagcagcaacatggtcagtagcagcagcaccagtagctccaca
gtacccgatgacctgagtctggcaccacccggctatgaggttagccaaaagctcgaggaa
cagcaacaacagcatgttgcaccggtggtgttgctgccaccaattgccaagcatcgcgag
ttgccggtcgatgtgccggatagtttcattgaaatggtaaagacaccacccagatatccg
ccaccggctcatctatcgtccaggggatccttgctatcgaatgccagtggttccaccgcc
cacaccacactctcctccctgggcgtggtcagtgtggcagcaacaacaacaacaacaccg
acaacaaccggagcagcagcaacatcacaagttgcaactgccattggcgatgagttaaat
ggaaatgcaaagcccgtgccacccccccgcgatcacttgcgggtggagaaggacgggcgg
ctcgtcaactgctcccccgccccccagctgccggatcggcgggcgcccggcaacgccagc
agcggcagcggcagtggcagcggcggtctcatcgccccccagcagatcgcccagatcgtg
gagcccaccatggagcagctggatagcatcaaaaagtaccaggagcaacttcgaaggcga
cgcgaagaggaggagcggattgcccagcagaatgagttcctgcggaacagtctgcgcggc
tccaggaagctcaaggctctccaggacaccactgccacgcccggcaaggcggtggcgcag
cagcaggcccaccaacaacagcaacagtccatgccccaggcggtgggcgtggagaacgag
gcgtacctgccggatgaggatcagcaggcgccccaggagcagatagatggctatggagaa
ctgatcgccgccctgacacgcctccagagccagctgagcaagagcggcctgagcaccctg
gcgggcagggtgtccgccgcccacaatgtcctggccagcgccagtgtggcccatgtcctg
gccgccaggacggccgtgctgcagcgccgcagaccccgcgtcgcaggacctctgcaccac
agcgccctcggcctgcagaaggacatcgtggagctgctgacgcaatcgaatacggcggct
gccatcgagctgggcaacctgctgaccagccacgagatggagggactcctcctggcccac
gatcgcatcgccaatcatacggacggcacaccctcgcccacatccacgggcacgcccacc
tcggcgatgacgcccacgccgggacaacagccgccggcggcgacgacgacgctgagcggt
cacagcagtccggtaaccagtgcgaaacgtaacttgggcatggtggtggcgccgccagtg
gtgccgccgccgttggcgcaacgcggcgccatgcccctgccacgcggggagtcgcctccg
ccgccgccaccgctaccggtgtccggcaatccgctggccatgccgatgagtgcttgtttc
gggacgctgaacgaccagaacgacaacatccggatcatccagatcgagaagtcgacggag
ccgctgggcgccaccgtgcggaacgagggcgaggcggtggtcattggccggatagtgcgg
ggcggagcggccgagaagtccggcctcctgcacgagggcgacgagatcctggaggtcaat
ggtcaggagctgcgcggcaagacggtgaacgaggtgtgcgccctgctgggtgccatgcag
ggcaccctcaccttcctcatcgtgccggccggtagtccaccgcccggcggcggcctggtc
ggtggcccgcagtccggacttggcaccggaccgggcgcccatcgggacactgccgtgctg
catgttcgcgcccatttcgattacgatccggaggatgatctgtatataccctgccgggag
ctgggcatcagcttccagaagggcgatgtcctgcacgtgatcagccgggaggatccgaac
tggtggcaggcgtatcgcgagggcgaggaggaccagacgctggccggtctcattcctagt
cagtcgttccagcaccagcgggagaccatgaagctggccattgccgaggaggcgggtctg
gcgaggtcccgcggcaaggacggatcgggcagcaaaggagccaccctgctctgtgcccgc
aagggacgcaaaaagaagaagaaggccagctcagaagcgggttatcctttgtacgctacc
acggcaccggatgaaacggatccggaggagatactcacctacgaggaggtggccttatac
tatccccgtgccacccacaagcggcccatcgtcctcatcggcccgcccaacatcggccgc
cacgagctccgccagcggctgatggccgactcggagaggttctccgccgccgtgccacac
acatccagggctcgcagagagggcgaggtgcccggcgtggactaccatttcatcaccagg
caggctttcgaggcggacatcctggcgcgacggttcgtggagcacggcgagtacgagaag
gcctactacggcacctccttggaggccatacgcactgtggtggccagcggcaagatctgt
gtcctgaatctgcatccccagagcctcaagctgctgcgtgcctccgacctgaagccctat
gtcgtcctggtggcgccacccagcctggacaagctgcgtcagaagaaactgcgcaacggc
gaacctttcaaggaagaagagctcaaagacatcattgccacggccagggacatggaggcc
agatggggccatctgttcgacatgataatcatcaacaatgacacggagcgcgcctaccac
caactgctggcggagatcaactcgctggagcgtgagccgcagtgggtgccggcacagtgg
gtgcacaacaaccgggacgagtcataa

DBGET integrated database retrieval system