KEGG   Drosophila ananassae: Dana_GF20842Help
Entry
Dana_GF20842      CDS       T01059                                 

Definition
GF20842 gene product from transcript GF20842-RA
Orthology
K08738  
cytochrome c
Organism
dan  Drosophila ananassae
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dan00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 104 aa AA seqDB search
MGADAENGKKIFVQKCAQCHTAEPGGKHKVGPNLGGIVGRKCGTASGYKYTDANIKKGVT
WTEGNLDEYLKDPKKYIPGTKMVFAGLKKAEDRADLIAYLKKNK
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcggatgccgaaaatggaaaaaagatcttcgttcagaagtgtgctcagtgccac
accgctgaaccgggtggcaagcacaaggtgggccccaatttgggcggtatcgtgggtcgc
aaatgtggcactgcctccggttacaaatacaccgatgccaatatcaagaagggtgttacc
tggaccgagggcaacctggacgagtatctcaaggatccgaagaaatacattcccggcacc
aaaatggtgtttgccggactgaaaaaagccgaggatcgggccgatttgatcgcctacctc
aagaaaaataagtag

DBGET integrated database retrieval system