KEGG   Drosophila ananassae: Dana_GF20842Help
Entry
Dana_GF20842      CDS       T01059                                 

Definition
(RefSeq) GF20842 gene product from transcript GF20842-RB
  KO
K08738  
cytochrome c
Organism
dan  Drosophila ananassae
Pathway
Sulfur metabolism
Metabolic pathways
Apoptosis - fly
Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dana_GF20842
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dana_GF20842
   04215 Apoptosis - multiple species
    Dana_GF20842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 104 aa AA seqDB search
MGADAENGKKIFVQKCAQCHTAEPGGKHKVGPNLGGIVGRKCGTASGYKYTDANIKKGVT
WTEGNLDEYLKDPKKYIPGTKMVFAGLKKAEDRADLIAYLKKNK
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcggatgccgaaaatggaaaaaagatcttcgttcagaagtgtgctcagtgccac
accgctgaaccgggtggcaagcacaaggtgggccccaatttgggcggtatcgtgggtcgc
aaatgtggcactgcctccggttacaaatacaccgatgccaatatcaagaagggtgttacc
tggaccgagggcaacctggacgagtatctcaaggatccgaagaaatacattcccggcacc
aaaatggtgtttgccggactgaaaaaagccgaggatcgggccgatttgatcgcctacctc
aagaaaaataagtag

DBGET integrated database retrieval system