KEGG   Drosophila ananassae: Dana_GF20860Help
Entry
Dana_GF20860      CDS       T01059                                 

Definition
(RefSeq) GF20860 gene product from transcript GF20860-RB
  KO
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dana_GF20860
Protein kinases [BR:dan01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Dana_GF20860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 972 aa AA seqDB search
MYRLEDTNSGGVMDKNKQKLSAYGSSAGSVAVVDAAQGSGSGSGGGGRQRHAPLYGRFVT
EEDLPATHRDVMHHHSSPSSSSEVRAMQARIPTHFRDPASGPLRKLSVELIKTYKHINEV
YYAKKKRRAQQTQGEDDSSNKKERKLYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGS
FGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYYIVKLKRHFM
WRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLK
PENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGC
ILVEMHTGEPLFSGCNEMDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVADGSYVLKKN
QNGRKYKPPGSRKLQDILGVDTGGPGGRRLDEPGHNVSDYLKFKDLILRMLDFDPKTRVT
PYYALQHNFFKRTADEATNTSGAGATANAGAGGSGSSGAGGGGGGGSSGSGGGGSGGNGG
GGAGGAGGLGAGSSNSGAVSSSSAAAAAAAAAAASSTSATGGSISGSGPGGVGGASSQPL
PMALPLPLPPLSGGGGPGVGASDGQCHGLLMHSSAAANAMNNFSALSLQPSHQPSSLVNR
TGNCSNSLNSLNHFSPPQQHHQQQQQQSSNNISNSNSISSNNNGNHNSLNSYPHAMECDP
PMAPPPPNGHGRMLRVPPMLPPGYAPLNLAPHHFYNNNMSSAAAAAAAAAAAAAAAAAAS
HLMMTDSSVISATAAGGGGAGGGGGGGGGAAVPGPVSGLSGGPSAPSVAVTPQAAAAAAA
AAAFHLFPSQPAYGAAPASLSELPMPLPPLPLSMPLPLPMPLPMPLQLPPSSSSASSTAS
TSASIGGGGGGGGGSLGVVGSRRHLGSHGGPPTAPQNVGGGSNSATGASSSDASSSSPMV
GVCVQQNPVVIH
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atgtatagattagaggacacgaatagcggcggcgttatggataaaaacaaacagaaatta
tccgcttatgggtccagcgcgggcagcgtcgccgtcgtcgatgcagcgcagggcagcggg
agcggcagcggtggcggcggtcgccagcggcacgcccccctctacggccgcttcgtcacc
gaggaggacctgcccgccactcaccgggatgtcatgcaccatcactctagtccctcgtct
tcgtcagaggtgcgtgccatgcaggcccgcattcccacccactttcgggaccccgcctcg
ggtcctctgcgaaagctgagcgtcgaactgataaagacctacaagcacatcaacgaggtc
tactatgcgaaaaagaagcgtcgtgcccagcaaacgcaaggcgaggacgactcctccaac
aagaaggagcgaaagctgtacaacgacggctacgacgatgataatcacgattatataatc
aagaatggcgaaaagtttttggatcgctacgagattgactcgctaatcggaaagggcagc
tttggtcaggtggtgaaggcctacgatcacgaggagcaatgccatgtggcgatcaagata
attaagaataagaaaccgttcctaaaccaggcacagatcgaggttaagctgctcgagatg
atgaatcgtgcagatgccgagaataaatactatatcgtcaagctcaagcgccattttatg
tggcgcaatcacctgtgcctggtgttcgagctgctctcatacaacctgtacgatctgctg
cggaacacaaacttccggggcgtatcgctgaacctcacgcgcaagttcgcccagcagcta
tgcacggcgctgctcttcctcagcacccccgaactgaacattattcactgtgatttgaag
cccgagaacatcttgctctgcaatccgaagcgttccgcgatcaagatcgttgactttggc
agctcctgtcagctgggacagcggatctaccactatatccaatcgcgcttctaccgctcc
ccggaagtactgctgggcatccaatatgatctggccattgatatgtggtcgctgggctgt
atcctggttgagatgcacaccggtgagccgctcttctccggctgcaacgaaatggaccag
atgaacaagatcgtcgaggtgctgggcatgccgcccaagtatcttctcgatcaggcgcac
aagacccgcaagttcttcgacaagatcgtcgccgacggatcctatgtcctcaagaagaac
caaaacggacgtaaatacaagccgccgggatcacgtaaactccaggatatactcggcgtg
gatacgggcggaccgggtggccggcgattggacgaacccggtcataatgtctccgattat
ctcaagttcaaggacctgatcctgcgcatgctcgacttcgatccgaagacaagggtcaca
ccctactacgccctgcagcacaacttcttcaagcgtacggcggacgaggcgaccaatacc
agcggtgcgggtgccacggcgaatgccggtgccggcggctccggttccagtggtgctggc
ggcggtggcggtggtggatcgagtggctccggtggcggtggctctggcggcaacggtggc
ggtggtgcgggcggtgccggtggcctcggtgctggtagcagcaacagtggagctgtgtcg
tcatccagtgcagctgcggctgcggcggcggcagcagcggccagttccacctcggctacg
ggtggctcgatttcaggatcgggtcctggcggagtcggtggcgcgtcgtcgcagccattg
ccgatggcgctgccgctgccactgccgcctctctcaggaggaggaggtcctggcgtcgga
gcgtcggatggccagtgtcatggccttctgatgcactcctcggcggcagccaatgcaatg
aacaacttctccgccctgagcctccagcccagccaccagccgagctctctggtgaaccgc
actggcaactgcagcaacagtctcaacagcctgaatcactttagtccaccgcagcagcat
catcagcaacagcagcagcaaagcagcaacaacatcagcaacagcaacagcatcagcagc
aacaacaacggcaaccacaacagcctcaacagctatccacacgccatggaatgtgaccca
ccaatggctccacccccaccaaatggacatggtaggatgctacgtgtaccaccgatgttg
ccacctggttatgcccccttgaatctggcgccgcatcatttctacaacaacaacatgtcc
tcggcagcagcagcagcagcggcagcagcagcagcagcagcagcggcggcagctgcctcc
catctcatgatgaccgattcgagtgtgataagcgccacagcagcgggtggtggtggtgcc
ggcggaggtggtggcggcggtggaggagcagcagtgccgggaccagtttcaggattaagt
ggaggaccaagtgcccccagtgtggcggtgacgccacaagcagccgctgctgctgcggcc
gccgctgcctttcatctgtttccgtcacagcccgcctatggagcagctcccgcctcgctg
agcgagctgccgatgcccttgccgccactgccgctctccatgcctctgcctctgcccatg
ccactgcccatgcccctccagctgccgccctcgtcatcatccgcctcctcaacagcctcc
acatcagcatctattggtgggggaggtggaggaggaggtggtagcctgggagtggtgggc
tcgaggcgacacttgggcagccacggtggacccccaacggccccccagaatgtgggtggt
gggagcaattcggccaccggagccagcagcagcgatgcctcctcctcgtcgccgatggtc
ggagtttgtgttcaacagaatcctgtagttatacattag

DBGET integrated database retrieval system