KEGG   Drosophila ananassae: Dana_GF20869Help
Entry
Dana_GF20869      CDS       T01059                                 

Definition
GF20869 gene product from transcript GF20869-RA
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
dan  Drosophila ananassae
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dan00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dan00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:dan04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 352 aa AA seqDB search
MNGRSIRINRLPATIVAILVTIMLVYFLNFHQEERPAIYGMLRSDNPNKVNLRKMLIAAI
QAAQRGGLEVLDVAHSRQLKERSKGKTDEGVNDPFTDADGRSHCVMKQGLQRIFPRVRIF
SEEDNEHCRQSHSFDLDPTVLHETAQVPDVMVNAPDVTVWVDPLDATKEYTEELYEYVTT
MVCVAVAGRPIIGVIHSPFNGQTAWAWVGNSMSEYLANLHPQHSQKSGDLAPIITVSRSH
TAGAKDLARGIFGEDVSLLTAAGAGYKVLQVVANNATAYLHTSKIKKWDICAGDAILHAL
GGTMTTLNDQLIHYGPDESPVNTEGLLATLERHEEYMDKLAKYRAAHNGKIA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaacggacgatccatacgcatcaaccggctgccggccaccattgtggcgattctggtg
accattatgctcgtctatttcctcaatttccatcaggaggagcgtccggccatttatggc
atgctgcgcagcgataatcccaacaaggtgaacctccgcaagatgctaattgccgccatc
caggccgcccagcgtggcggactcgaggtgctcgacgtggcccattcccgccagctgaag
gagcgcagcaagggcaagacggacgagggtgtcaatgatccattcacggacgccgacggt
cgttcccactgcgtcatgaaacagggcctgcagaggatcttccctcgcgtcaggatcttc
tccgaggaggacaacgaacactgccgccagtcgcatagctttgatctcgatcccacggtc
ctgcacgagacggcccaggtgcccgacgtgatggtgaatgctccggatgtcacggtctgg
gtggatccgctggacgccaccaaggagtacaccgaggagctgtacgagtacgtcaccacc
atggtgtgtgtggcagtggccggaaggcccatcatcggtgtgattcacagtccgttcaac
ggccagacagcctgggcctgggtgggcaactcgatgtccgagtatctggccaatctgcat
ccccagcactcacaaaagtccggcgatttggcgccgatcatcaccgtttcccgctcccat
acggccggggccaaggatctggcccgtggcatcttcggcgaggatgtgagcctgctgaca
gccgccggcgctggctataaggtgctccaggtggtggccaacaatgctaccgcctatctg
cacacctccaagatcaagaaatgggacatctgtgccggagacgccatcctgcatgccctc
ggtggcactatgacgaccctgaacgatcaactcatccactacggtcccgatgagtcgccg
gtgaacacggagggtctgctggcgacgctggagcggcacgaggagtacatggacaagttg
gccaagtaccgggcggctcacaacggcaagatagcgtga

DBGET integrated database retrieval system