KEGG   Drosophila ananassae: Dana_GF20869Help
Entry
Dana_GF20869      CDS       T01059                                 

Definition
(RefSeq) GF20869 gene product from transcript GF20869-RA
  KO
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
dan  Drosophila ananassae
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dana_GF20869
  Energy metabolism
   00920 Sulfur metabolism
    Dana_GF20869
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Dana_GF20869
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dana_GF20869
    3.1.3.25  inositol-phosphate phosphatase
     Dana_GF20869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 356 aa AA seqDB search
MPDKMNGRSIRINRLPATIVAILVTIMLVYFLNFHQEERPAIYGMLRSDNPNKVNLRKML
IAAIQAAQRGGLEVLDVAHSRQLKERSKGKTDEGVNDPFTDADGRSHCVMKQGLQRIFPR
VRIFSEEDNEHCRQSHSFDLDPTVLHETAQVPDVMVNAPDVTVWVDPLDATKEYTEELYE
YVTTMVCVAVAGRPIIGVIHSPFNGQTAWAWVGNSMSEYLANLHPQHSQKSGDLAPIITV
SRSHTAGAKDLARGIFGEDVSLLTAAGAGYKVLQVVANNATAYLHTSKIKKWDICAGDAI
LHALGGTMTTLNDQLIHYGPDESPVNTEGLLATLERHEEYMDKLAKYRAAHNGKIA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcccgataaaatgaacggacgatccatacgcatcaaccggctgccggccaccattgtg
gcgattctggtgaccattatgctcgtctatttcctcaatttccatcaggaggagcgtccg
gccatttatggcatgctgcgcagcgataatcccaacaaggtgaacctccgcaagatgcta
attgccgccatccaggccgcccagcgtggcggactcgaggtgctcgacgtggcccattcc
cgccagctgaaggagcgcagcaagggcaagacggacgagggtgtcaatgatccattcacg
gacgccgacggtcgttcccactgcgtcatgaaacagggcctgcagaggatcttccctcgc
gtcaggatcttctccgaggaggacaacgaacactgccgccagtcgcatagctttgatctc
gatcccacggtcctgcacgagacggcccaggtgcccgacgtgatggtgaatgctccggat
gtcacggtctgggtggatccgctggacgccaccaaggagtacaccgaggagctgtacgag
tacgtcaccaccatggtgtgtgtggcagtggccggaaggcccatcatcggtgtgattcac
agtccgttcaacggccagacagcctgggcctgggtgggcaactcgatgtccgagtatctg
gccaatctgcatccccagcactcacaaaagtccggcgatttggcgccgatcatcaccgtt
tcccgctcccatacggccggggccaaggatctggcccgtggcatcttcggcgaggatgtg
agcctgctgacagccgccggcgctggctataaggtgctccaggtggtggccaacaatgct
accgcctatctgcacacctccaagatcaagaaatgggacatctgtgccggagacgccatc
ctgcatgccctcggtggcactatgacgaccctgaacgatcaactcatccactacggtccc
gatgagtcgccggtgaacacggagggtctgctggcgacgctggagcggcacgaggagtac
atggacaagttggccaagtaccgggcggctcacaacggcaagatagcgtga

DBGET integrated database retrieval system