KEGG   Drosophila ananassae: Dana_GF20874Help
Entry
Dana_GF20874      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
dan  Drosophila ananassae
Pathway
MAPK signaling pathway - fly
Protein processing in endoplasmic reticulum
Apoptosis - fly
Toll and Imd signaling pathway
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dana_GF20874
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dana_GF20874
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dana_GF20874
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    Dana_GF20874
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dana_GF20874
Protein kinases [BR:dan01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dana_GF20874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1170 aa AA seqDB search
MSTIEFETIGSRLQSLEAALQAQNESHDQIVLSNSRGSSSTTTTTSSSSSSSVVAAHSRH
APPSAASSASASVTSPPGIGMGTGGGISIVHRPAPPVPQTAPASVSASSGSASRSGSSAM
LSGSFVPPTTRSPRPTPNLPLNVDGGSFRPRIMRLPLPTQSHPSETETDKKLKIIMAQTG
KLNINGRQFPTDINDLRHLGDLGNGTSGNVVKMLHQSSNTIIAVKQMRRTGNAEENKRIL
MDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLKLTKKPVPERILGKVTV
ATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAYM
APERIDPKKPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPSGE
GFNFSQEFQDFVIKCLTKNHQERPKYPELLAQPFIRIYETAKVDVPNWFQSVRGNGADPA
LKRATAAGGGSGSSGYGRATQSPQKTIKPTQIPSYQQQSQYFMQSATQLPQTTATATAPT
GAGSGSGSGSGSASGPGIGSVNCFSGNGSSSGNRSGSGSGSSNSASPLSPPSGAPAGGDL
SKLYRKSPFMQRKLSNGSSYHHSHYKYNDESPKKESMFSSIGQSILRNLTTSPFSQKKHH
TVATTLATTTTTTLPHNNKQTYNTVATTATTPATATATATATVTATTPTWRLPADNSQTY
DSCDSSTNANLGLTTPSPSLQRKQLTPDQQQQQQQQQPLRLQPGNQSPILLQRFYHQQNQ
LREKEAAERYQQQRQQPPLTSTNPFHSNYVAPPPSTHSTSSQSSTQSNCSQIAVSPSTGM
RLGLGQGSGSGSGSGSIAGIGAAPEAAAGHFGAGGTGEHLQYQPLPIGGSATDSATASAT
TSPSSLLPRSPEQQPTEYGGGQLPGSMVTSKLSKLYARRQLLGQSSTTSSGASNSSLDGC
SREQHDAATSPVAANSCSIPEPETIQSPPQPPAYRTIVNNGGGVSGGAGAKSYYYRTLSA
ASSSSNTSQSTSPTTEPLPGSASVGGSFLRRGIALGGAGGSMSTPPSPHILAGLDRRHRS
PDPPPRYNRGQSPLLLRKNLLELSGQPPGSPLLHRRYVSASPPLPPPRRGSESVPGSPQH
FRTRIHYTPEPQRRIYRTIDQXVALQIMVM
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccatcgagttcgagaccatcggcagtcgcctgcaatcgttggaagcggcgctc
caggcccagaacgagtcccacgaccaaatagtgctctctaattcgcgcggcagctcctcc
accaccaccaccacctcctcctcctcctcctcctccgttgtcgccgcccacagccgccat
gcaccgccgtcagccgcctcatccgcatccgcatccgtcacatccccaccgggcatcggc
atgggtaccggtggcggtattagcatagtccaccggccagctcctccagttcctcagaca
gcgccagcctccgtctccgcctcctcaggatccgcctcgagatcaggatcgtccgcgatg
ctaagcggctcctttgtcccgcccacgaccaggagtcccaggcctacgcccaatctgcca
ttaaatgtcgatggtggctccttccggccgcgcatcatgcgacttccgcttccgacgcaa
tcgcatccctcggaaacggaaacggacaagaaactgaagatcataatggcccagacgggc
aagctgaacatcaacggccggcaattccccacggacatcaacgatctgcggcacctgggc
gatctgggcaatgggaccagtggcaacgtggtcaagatgctccaccagtcgagcaacacc
atcattgccgtcaaacagatgcgacgcaccggcaatgccgaggagaacaaacgcatccta
atggatctggatgtggttctgaagtcgcacgactgcaagtacattgtcaagtgtttggga
tgttttgtgcgagatccggatgtgtggatctgcatggaactgatgtccatgtgcttcgac
aaactgctcaagctcaccaagaagccagtgcccgaacgtatcctgggcaaggttacagtg
gcgacggttaatgccctgtcgtatctgaaggacaagcacggtgtcatccatcgggatgtg
aagccctcaaacatcctgatcgacgagcgcgggaacatcaagctctgtgatttcgggatc
agtggtcgtctggtggactccaaggctaatacacgttctgctggctgtgctgcttacatg
gcgccggagcggattgatcctaaaaaaccaaagtacgacattcgggccgatgtatggtcg
ctgggcataacgctggtggaactggccacagcgcgatccccctacgagggctgcaatacg
gacttcgaggtgctgaccaaggtgctagactcggagccaccatgtctgcccagcggagag
ggcttcaattttagtcaagagtttcaggattttgtaatcaagtgcctcacaaagaaccac
caggagcgacccaagtatccggagcttctggcccagccctttatccggatatacgaaaca
gccaaagtagatgtacccaattggtttcagagcgtccgcggcaacggcgctgatccagcg
ctgaagagggcaacagcagctggaggtggttcgggatcatccggatatggcagggcgact
cagagtccccaaaagacaataaaaccaacccagataccgagttaccagcagcagtcgcag
tatttcatgcaatcagccacacaactacctcaaacaacagcaacagcaacagcgccaaca
ggagcaggatcaggatcaggatcaggatcgggatcagcatcaggacctggtattggatct
gtgaattgttttagcggcaatggaagtagcagcggtaatcgaagtggcagtggtagtggc
agcagcaacagtgccagtcccttgtcacctccatccggtgctccagctggtggcgatctt
agcaagctctaccggaaatcgccgtttatgcaacggaaactgagcaatggatcgtcttat
catcactcgcactacaaatacaatgatgagagccccaaaaaggagtccatgttcagcagc
atcggtcagtcgattctccgcaatctaacaacatcgccctttagccaaaagaaacatcat
acagtagcaacgacattagcaacaacaacaacaacaacactgccgcacaacaacaagcaa
acatacaatactgttgcaacaacagcaacaacaccagcaacagcaacagcaacagcaaca
gcaacagtgacagcaacaacacccacttggcgcctgccagcggacaattcccaaacttac
gacagctgtgatagtagtactaatgcgaatctgggtctcaccacgccctcaccctcgctg
cagcggaaacaactgacaccggaccaacagcagcagcagcaacagcagcaacctctaaga
ttgcagccagggaatcaaagtcccatattgctgcaacgcttctatcatcaacaaaatcag
ttgcgagaaaaggaggcggccgaacggtatcagcaacagcgccagcaaccaccactgacc
agcaccaatccgtttcacagcaactatgtggcgccaccgccctccacacactccacctcg
agccaatcctccactcagtctaactgctcacaaatagctgtttcgccatcaaccggaatg
agattgggattgggacagggatcaggatcaggatcaggatctggttcaatagcaggaata
ggagctgcacccgaggcggctgccgggcacttcggagcaggtggcactggcgagcacttg
caataccagccactgcccattggcggcagtgccactgactccgccactgcgtcggcaact
acaagtccctcctcgctcctgccccgatcccccgaacaacagccgacggagtatggtggt
gggcagctgcccggttcgatggtgaccagtaagttgagtaaactctacgcccggcgccag
ctattgggacagagttcgacgaccagcagcggggccagcaacagtagcctggacggatgc
agtcgggagcagcacgatgctgccacatcaccggtggcggccaatagctgcagcatcccc
gaacccgaaacgatccaatctccgccccagccaccagcctacaggactatagttaacaat
ggcggtggagttagtggcggtgctggggcaaagtcctactattatcgcaccttgtcggcg
gcgagcagcagcagcaacaccagccagagcacctcacccaccacagaacccctgccgggc
agtgcatcggtcggtggcagtttcctgcgtcgtgggattgctctgggtggtgctggtggt
agtatgagcacaccgcccagcccacacatcctggccggactggatcggaggcatcggagt
ccggatccaccgccgcgctacaatcgcggccaatcgccgctgttgcttaggaagaatctg
ctggagctgagtggacagccacctggttcgccgcttctacaccgaaggtatgtttcggca
tcgccaccactgccaccgccacgtcgcggctcggagagtgtcccgggctcaccgcagcac
ttccgcactcgcatccactatacccccgagccacagagacgcatctaccggacgatagac
caatgagtggcactgcaaatcatggtcatgtga

DBGET integrated database retrieval system